DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG11529

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:208 Identity:57/208 - (27%)
Similarity:100/208 - (48%) Gaps:23/208 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GTIISNQWILTV-KTVLKYSYIEVHLASR----RSYRGFDIIRIYK--ENFRFHYD---NDHVIA 112
            ||::..:||||. ...:..::.:|:|.::    ....|..::|..|  .:.||:.:   ||  ||
  Fly    61 GTLLDKRWILTAGHCTMGVTHYDVYLGTKSVEDTEVSGGLVLRSNKFIVHERFNPETAAND--IA 123

  Fly   113 LVKCPYQ-KFDRRMDRVRVPA-YDTRFERYVGNMTMVCGYG--TEKRHAKLPEWMRCIEVEVMNN 173
            |||.|.. .|..|:....:|: |  |.:::.|...:..|:|  .|..::   :.|:..|::|::|
  Fly   124 LVKLPQDVAFTPRIQPASLPSRY--RHDQFAGMSVVASGWGAMVEMTNS---DSMQYTELKVISN 183

  Fly   174 TECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMP-ENCSIGYPSVHIR 237
            .|||:.|..:....:|..|...:.||.||.||.:| :......:||....| :.|....|....|
  Fly   184 AECAQEYDVVTSGVICAKGLKDETVCTGDSGGPLV-LKDTQIVVGITSFGPADGCETNIPGGFTR 247

  Fly   238 VSDHIKWIKRVSG 250
            |:.::.||:...|
  Fly   248 VTHYLDWIESKIG 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 54/201 (27%)
Tryp_SPc 26..248 CDD:304450 56/204 (27%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 56/204 (27%)
Tryp_SPc 37..255 CDD:214473 54/201 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.