DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG18179

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:252 Identity:76/252 - (30%)
Similarity:132/252 - (52%) Gaps:11/252 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TLLVLSLTVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVK 70
            |.|:..:|:|.|.:.    ||..||.|......|:||::.....::|...||||||::.||||..
  Fly    24 TSLLPQVTISEGAEG----RIVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAA 84

  Fly    71 TVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFH----YDNDHVIALVKCPYQKFDRRMDRVRVP 131
            ..|...|:|:|..|...:.|.....:.::||..|    .:....|.|::.|...|...:::|.:|
  Fly    85 HCLTTDYVEIHYGSNWGWNGAFRQSVRRDNFISHPNWPAEGGRDIGLIRTPSVGFTDLINKVALP 149

  Fly   132 AYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPLKWYEMCTSGEGFK 196
            ::....:|:|....:.||:| ...:..|.:|::|::|::::|:||.:.|..:...:|||.....|
  Fly   150 SFSEESDRFVDTWCVACGWG-GMDNGNLADWLQCMDVQIISNSECEQSYGTVASTDMCTRRTDGK 213

  Fly   197 GVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIKWIKRVSGVGF 253
            ..|.||.||.:|| ..|...:|:|.....:|..| ||.:.||:|::.||:..:|:.:
  Fly   214 SSCGGDSGGPLVT-HDNARLVGVITFGSVDCHSG-PSGYTRVTDYLGWIRDNTGISY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 68/223 (30%)
Tryp_SPc 26..248 CDD:304450 69/225 (31%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 68/223 (30%)
Tryp_SPc 40..263 CDD:238113 69/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470978
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.