DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG8329

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648339.1 Gene:CG8329 / 39123 FlyBaseID:FBgn0036022 Length:259 Species:Drosophila melanogaster


Alignment Length:266 Identity:87/266 - (32%)
Similarity:136/266 - (51%) Gaps:25/266 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KLVVTLLVLSLTVSVGEKNKLS-----PR--IAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGA-- 57
            |||:.||.::...:...:|:.:     |:  |..||.|......|.||:        .:|.||  
  Fly     4 KLVLLLLFVATVCAHRNRNRTAHHGGGPKDIIVNGYPAYEGKAPYAVGL--------RMNNGAVG 60

  Fly    58 -GTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFH--YDND--HVIALVKCP 117
             |::|.|.|:||....|....:.:|..|.|::.|.....:.|.||..|  |.|.  |.|.|::.|
  Fly    61 GGSVIGNNWVLTAAHCLTTDSVTIHYGSNRAWNGQLQHTVNKNNFFRHPGYPNSAGHDIGLIRTP 125

  Fly   118 YQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTP 182
            |..|...:::|.:|.:..:.||:.....:.||:| ...:..|.:|::|::|:|::|.|||:.|..
  Fly   126 YVSFTNLINKVSLPKFSQKGERFENWWCVACGWG-GMANGGLADWLQCMDVQVISNGECARSYGS 189

  Fly   183 LKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIKWIKR 247
            :...:|||.....|.||.||.|||:|| ..||..:|:|......|..| ||.:.|||||:.||:.
  Fly   190 VASTDMCTRATDGKSVCGGDSGGALVT-HDNPIQVGVITFASIGCKSG-PSGYTRVSDHLDWIRE 252

  Fly   248 VSGVGF 253
            .||:.:
  Fly   253 KSGIAY 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 76/228 (33%)
Tryp_SPc 26..248 CDD:304450 78/228 (34%)
CG8329NP_648339.1 Tryp_SPc 35..253 CDD:238113 78/228 (34%)
Tryp_SPc 35..250 CDD:214473 76/225 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470970
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BS0R
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.