DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG3088

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:262 Identity:76/262 - (29%)
Similarity:130/262 - (49%) Gaps:19/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVTLLVLSLTVSVGEKNKLSPR----IAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTII 61
            |||:|..|.|:| |:.|...|.|..    |..|..|......|:||:.:.:|..    :.:||||
  Fly     1 MKLLVVFLGLTL-VAAGSAKKDSEDPDHIITNGSPAYEGQAPYVVGMAFGQSNI----WCSGTII 60

  Fly    62 SNQWILT-VKTVLKYSYIEVHL-ASRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCPYQKFDRR 124
            .:.|||| .:.:...|.:.::. |:|.|...|.:.....|   :...|.| :|||:.|...|..|
  Fly    61 GDTWILTSAQCLTGSSGVTIYFGATRLSQAQFTVTVGTSE---YVTGNQH-LALVRVPRVGFSNR 121

  Fly   125 MDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYY--TPLKWYE 187
            ::||.:|:...|.:||......|||:|.......|.:.::|:::::|:|.||..:|  |.:....
  Fly   122 VNRVALPSLRNRSQRYENWWANVCGWGVTTFSNGLTDALQCVDLQIMSNNECIAFYGSTTVSDQI 186

  Fly   188 MCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPEN-CSIGYPSVHIRVSDHIKWIKRVSGV 251
            :||.....:..|.||.|..::|. .:.|.:||...:..| |::|.|:...|::..:.||.:.:|:
  Fly   187 LCTRTPSGRSTCFGDAGSPLITK-QDSTVVGISAFVASNGCTLGLPAGFARITSALDWIHQRTGI 250

  Fly   252 GF 253
            .:
  Fly   251 AY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 62/228 (27%)
Tryp_SPc 26..248 CDD:304450 64/226 (28%)
CG3088NP_648334.1 Tryp_SPc 29..246 CDD:238113 64/225 (28%)
Tryp_SPc 29..244 CDD:214473 62/223 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470982
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.