DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG33465

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:213 Identity:46/213 - (21%)
Similarity:80/213 - (37%) Gaps:52/213 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSY-RGFDIIRIYKENFRFHYDNDHVIALVKCP 117
            |..:|.:|:|:::|||.:.  :..|.:.:.....| :.||:..|:......|...|:.|||:|..
  Fly   300 NTFSGVLITNRFVLTVASA--FPNIPLVMKVETKYLKSFDVESIHTHPRFTHSSMDNNIALLKLA 362

  Fly   118 YQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWM--------------RCIEV 168
            :.          ||..|.        :..:|...:    .|||..:              |.:.:
  Fly   363 HD----------VPNSDL--------VKPICIVPS----PKLPRMLTTLVDETTNDFRGVRNVTL 405

  Fly   169 EVMNNTECAKYY-TPLKWYEMCTSGE-GFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGY 231
            ..:|:.|||:.. .|||..:.|.:.. .||....|.|.|....:|....:. :..||      .|
  Fly   406 NAINHIECARRIGKPLKSNQFCVAQPIDFKVQAPGSIIGTYRNIGDGNRYY-LFGLM------SY 463

  Fly   232 PS----VHIRVSDHIKWI 245
            ..    |:..:..::.||
  Fly   464 SKDGMVVYTYIQSYLDWI 481

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 44/211 (21%)
Tryp_SPc 26..248 CDD:304450 46/213 (22%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113
Tryp_SPc 46..261 CDD:214473
Tryp_SPc 293..484 CDD:304450 46/213 (22%)
Tryp_SPc 293..481 CDD:214473 44/211 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436409
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.