DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG10469

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:274 Identity:72/274 - (26%)
Similarity:130/274 - (47%) Gaps:45/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVLSLTVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIV-YFKSQTSSLNYGAGTIISNQWILTVK 70
            :|::..::..|::.. |.||..|..||...:.|.||:: ||:......|...|||:||:||:|..
  Fly     6 VLIVQFSLVFGQETG-SLRIMNGTAAKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAA 69

  Fly    71 TVLK-----YSYIEVHLASRRSYRGFDII------RIYKENFRFHYDNDHVIALVKCPYQ-KFDR 123
            ..|:     ...:.:|:...:|:...:|:      .::|:..|....||  |||:|.|.: .|::
  Fly    70 HCLQDPKSNLWKVLIHVGKVKSFDDKEIVVNRSYTIVHKKFDRKTVTND--IALIKLPKKLTFNK 132

  Fly   124 RMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLP-EWMRCIEVEVMNNTECAKYYTPLKWYE 187
            .:...::|:..   :.|.|...::.|:|...:  :|| :.::.|...:::|.||.:     :|.:
  Fly   133 YIQPAKLPSAK---KTYTGRKAIISGWGLTTK--QLPSQVLQYIRAPIISNKECER-----QWNK 187

  Fly   188 --------------MCTSGEGFKGV-CEGDIGGAVVTMGPNPTFIGII-WLMPENCSIGYPSVHI 236
                          :|...:  ||: |.||.||.:|....:.|.:||: ......|.:..|.|..
  Fly   188 QLGGKSKKVVHNGFICIDSK--KGLPCRGDSGGPMVLDDGSRTLVGIVSHGFDGECKLKLPDVST 250

  Fly   237 RVSDHIKWIKRVSG 250
            |||.::||||..||
  Fly   251 RVSSYLKWIKYYSG 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 64/249 (26%)
Tryp_SPc 26..248 CDD:304450 66/251 (26%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 64/249 (26%)
Tryp_SPc 24..260 CDD:238113 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470682
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.