DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG6462

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:252 Identity:64/252 - (25%)
Similarity:112/252 - (44%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVL---------------- 73
            |||||..|......|.||:|...|....:..| |::|:.|::||....|                
  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCG-GSLITLQFVLTAAHCLTDAIAAKIYTGATVFA 139

  Fly    74 --KYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCPYQ-KFDRRMDRVRVPAYDT 135
              :.|..|:.:..|      |.| ||.:...|...:|  :||::.|.: :...::..:.:.....
  Fly   140 DVEDSVEELQVTHR------DFI-IYPDYLGFGGYSD--LALIRLPRKVRTSEQVQPIELAGEFM 195

  Fly   136 RFERYVGNMTMVCGYG-----TEKRHAKLPEWMRCIEVEVMNNTECAKYYTP---LKWYEMCTSG 192
            .....||.:..:.|:|     |:||    ...::.::.||::...|..|:.|   .:...:||.|
  Fly   196 HQNFLVGKVVTLSGWGYLGDSTDKR----TRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDG 256

  Fly   193 EGFKGVCEGDIGGAVVTMGPNPTF-IGII-WLMPENCSIGYPSVHIRVSDHIKWIKR 247
            ...:|.|.||.||.||....|.:: ||:. :...|.|.:|.|:|:.|::.::.||::
  Fly   257 SNGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 62/248 (25%)
Tryp_SPc 26..248 CDD:304450 63/251 (25%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 62/248 (25%)
Tryp_SPc 77..314 CDD:238113 63/251 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.