DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG10477

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001303385.1 Gene:CG10477 / 38679 FlyBaseID:FBgn0035661 Length:272 Species:Drosophila melanogaster


Alignment Length:286 Identity:68/286 - (23%)
Similarity:119/286 - (41%) Gaps:51/286 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVTLLVLSLTVSVGEKNKLSP--------------RIAGGYRAKTFTIIYLVGIVYFKSQTS 51
            ||:...|::...|||.....:.:|              ||..|.:|......|.||: .|||...
  Fly     1 MKVFAVLVLAIATVSADILRQDTPVHPRDSSAVPSIDGRITNGNKAAANQFPYQVGL-SFKSSAG 64

  Fly    52 SLNYGAGTIISNQWILTV---------------KTVLKYSYIEVHLASRR--SYRGFDIIRIYKE 99
            |...| |:||:|.|:||.               .||...:.::..::|.:  .:.|::...:   
  Fly    65 SWWCG-GSIIANTWVLTAAHCTKGASSVTIYYGSTVRTSAKLKKKVSSSKFVQHAGYNAATL--- 125

  Fly   100 NFRFHYDNDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYG-TEKRHAKLPEWM 163
                  .||  |:|:|.|...|...::::.:||..:.:..|.|...:..|:| |......:...:
  Fly   126 ------RND--ISLIKTPSVTFTVSINKIALPAIASSYSTYAGQTAVASGWGRTSDSSIAVATNL 182

  Fly   164 RCIEVEVMNNTECAKYY--TPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII-WLMPE 225
            :..:.:|:.|..|.|.:  :.:....:|......|..|:||.||.:..   |...||:. ::..:
  Fly   183 QYAQFQVITNAVCQKTFGSSVVTSGVICVESINKKSTCQGDSGGPLAL---NNRLIGVTSFVSSK 244

  Fly   226 NCSIGYPSVHIRVSDHIKWIKRVSGV 251
            .|....|:...||:.::.|||..|||
  Fly   245 GCEKNAPAGFTRVTSYLDWIKNQSGV 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 55/240 (23%)
Tryp_SPc 26..248 CDD:304450 57/242 (24%)
CG10477NP_001303385.1 Tryp_SPc 39..264 CDD:214473 55/240 (23%)
Tryp_SPc 40..267 CDD:238113 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.