DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG13527

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:281 Identity:64/281 - (22%)
Similarity:115/281 - (40%) Gaps:57/281 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVTLLVLSLTVSVGEKNKLSPRIAGGYRAKTFTII-YLVGIVYFKSQTSSLNYG-----AGTII 61
            :::|::|: |:.:...|...||:..|.   :|..:. |:|.|   :|:|.:..:|     .|.::
  Fly    10 ILITVMVI-LSGAHRMKRLSSPKFHGD---ETLELAKYVVSI---RSRTPNKYFGDNHYCGGGLL 67

  Fly    62 SNQWILTV--------KTVLKYSYIEVHLASRRSYR---GFDII----RIY-KENFRFHYDNDHV 110
            ||||::|.        |.:.|..::.|...|....|   |..:.    .:| .:||..|  |...
  Fly    68 SNQWVITAAHCVMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMH--NTFN 130

  Fly   111 IALVKCPYQKFDRRMDRVRVPAYDTRF--------ERYVGNMTMVCGYGTEKRHAKLPEWMRCIE 167
            :||:|.          :.::|:.|.|.        ...:|....|.|:|.......|...:..::
  Fly   131 MALMKL----------QEKMPSNDPRIGFLHLPKEAPKIGIRHTVLGWGRMYFGGPLAVHIYQVD 185

  Fly   168 VEVMNNTECAKYYTPLKWYEMCTSGEGF---KGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCS- 228
            |.:|:|..|..|:.......||.....:   ...|.||||..:::   ....:||: ..|..|. 
  Fly   186 VVLMDNAVCKTYFRHYGDGMMCAGNNNWTIDAEPCSGDIGSPLLS---GKVVVGIV-AYPIGCGC 246

  Fly   229 IGYPSVHIRVSDHIKWIKRVS 249
            ...|||:..|...::||:..:
  Fly   247 TNIPSVYTDVFSGLRWIRHTA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/253 (22%)
Tryp_SPc 26..248 CDD:304450 58/255 (23%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 56/241 (23%)
Tryp_SPc 43..263 CDD:214473 54/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.