DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG30283

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:285 Identity:65/285 - (22%)
Similarity:110/285 - (38%) Gaps:71/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LVVTLLVLSLTVSVGEKN-----------KLSP-RIAGGYRAKTFTIIYLVGIVYFKSQTSSLNY 55
            :||.||..|..|.:|.::           .:|. :|.||:.|...:..::..::    .....:.
  Fly     8 VVVVLLAASSVVVLGSESGSFLEHPCGTVPISQFKILGGHNAPVASAPWMAMVM----GEGGFHC 68

  Fly    56 GAGTIISNQWILTVKTVLKYSYIEVHL------ASRRSYR----------GFD-----IIRIYKE 99
            | ||:|:|:::||....:....::|.|      |..:.:.          .||     ::|:.| 
  Fly    69 G-GTLITNRFVLTSAHCIANGELKVRLGVLEREAEAQKFAVDAMFVHTDYYFDQHDLALLRLAK- 131

  Fly   100 NFRFHY-DNDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYG-TEKRHAKLPEW 162
              |.|| ||...|.|:..|..|        .:..:..:|..|        |:| ||.|.:.  ..
  Fly   132 --RVHYSDNISPICLLLDPLVK--------NIDEHIVKFRTY--------GWGKTESRSSS--RM 176

  Fly   163 MRCIEVEVMNNTECAKYY--TPLKWYEMCTSGEGFKGVCEGDIGG---AVVTMG-PNPTF-IGII 220
            ::...:..::.:||||.|  ..:....:|..... ...|.||.||   |:||.. ....| .|:.
  Fly   177 LQKTSLFNLHRSECAKQYPHQQINRNHICAESAN-ANTCNGDSGGPLTAIVTYDHVQMVFQFGVT 240

  Fly   221 WLMPENCSIGYPSVHIRVSDHIKWI 245
            .....:||  ..:|...|..|:.||
  Fly   241 SFGHADCS--KATVFTNVMTHLDWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 55/249 (22%)
Tryp_SPc 26..248 CDD:304450 57/250 (23%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 55/249 (22%)
Tryp_SPc 43..266 CDD:238113 57/250 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.