DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and try-9

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001021891.1 Gene:try-9 / 3565941 WormBaseID:WBGene00023425 Length:279 Species:Caenorhabditis elegans


Alignment Length:254 Identity:43/254 - (16%)
Similarity:75/254 - (29%) Gaps:106/254 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 SQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIA 112
            |:...:.:|.||::|...|:|...::..|...:......:.|....:|.|| ||         :|
 Worm    20 SENEFVQHGTGTLVSPWHIVTAAHLIGISEDPLPDCDTGNLREAYFVRDYK-NF---------VA 74

  Fly   113 LVK--CPYQKFDR---RMDRVRVPAYDTRFER--YVGNMTMVCGYGTEKRHAKLPEWMRCIEVEV 170
            .|.  |...:..:   |.|..:..|..:.:.|  |||:                    .||:.|.
 Worm    75 FVNVTCAVPEMCKGLHRKDMFKPLAIKSLYIRKGYVGD--------------------GCIDRES 119

  Fly   171 MNNTECAKYYTPLKW----------------------YEM------------------------- 188
            .|:....:...|:::                      |::                         
 Worm   120 FNDIAVFELEEPIEFSKDIFPACLPSAPKIPRIRETGYKLFGYGRDPSDSVLESGKLKSLYSFVA 184

  Fly   189 -CTSGEGFKGV-----------CEGDIGGAVVTMGPN---PTFIGIIWLMPENCSIGYP 232
             |:....:.||           |:||.|..||.....   ...:|::       |.|.|
 Worm   185 ECSDDFPYGGVYCTSAVNRGLSCDGDSGSGVVRTSDTRNVQVLVGVL-------SAGMP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 43/254 (17%)
Tryp_SPc 26..248 CDD:304450 43/254 (17%)
try-9NP_001021891.1 Tryp_SPc 30..237 CDD:389826 41/244 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.