Sequence 1: | NP_729255.2 | Gene: | sphinx1 / 318005 | FlyBaseID: | FBgn0052383 | Length: | 253 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001021891.1 | Gene: | try-9 / 3565941 | WormBaseID: | WBGene00023425 | Length: | 279 | Species: | Caenorhabditis elegans |
Alignment Length: | 254 | Identity: | 43/254 - (16%) |
---|---|---|---|
Similarity: | 75/254 - (29%) | Gaps: | 106/254 - (41%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 SQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIA 112
Fly 113 LVK--CPYQKFDR---RMDRVRVPAYDTRFER--YVGNMTMVCGYGTEKRHAKLPEWMRCIEVEV 170
Fly 171 MNNTECAKYYTPLKW----------------------YEM------------------------- 188
Fly 189 -CTSGEGFKGV-----------CEGDIGGAVVTMGPN---PTFIGIIWLMPENCSIGYP 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sphinx1 | NP_729255.2 | Tryp_SPc | 25..245 | CDD:214473 | 43/254 (17%) |
Tryp_SPc | 26..248 | CDD:304450 | 43/254 (17%) | ||
try-9 | NP_001021891.1 | Tryp_SPc | 30..237 | CDD:389826 | 41/244 (17%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24260 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |