DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG17572

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:274 Identity:64/274 - (23%)
Similarity:104/274 - (37%) Gaps:60/274 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EKNKLSPR-IAGGYRAKTFTIIYLVGIVYFKS-QTSSLNYG-AGTIISNQWILTVKTVL------ 73
            |||::..: :..|:..|.......|..:.||. .|.:..|. ||.:|:.:.|||.....      
  Fly   119 EKNQVCGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADG 183

  Fly    74 -KYSYIEV---------------HLASRRSYRGFDIIRIYKENFRFHYDNDHVIALVKCPYQKFD 122
             :.|.:.|               ..|.|........:.::.:..:..|.:|..:.::|.|   .:
  Fly   184 HRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTP---LN 245

  Fly   123 RRMDRVRVPAYDTRFERYVGNMTMVCGYG---------TEKRHAKLP--EWMRCIE-------VE 169
            ..:....:....||....||....:.|:|         .|..|..:|  .|..|:.       :|
  Fly   246 YSVATQPICLQKTRANLVVGKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALE 310

  Fly   170 VMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTF--IGIIWLMPENC-SIGY 231
            ..|:.|.       :|  ||..||| |.||:| .|||.:.:..|..|  |||:....:|| .:..
  Fly   311 SPNSIEG-------QW--MCAGGEG-KDVCQG-FGGAPLFIQENGIFSQIGIMSFGSDNCGGLRI 364

  Fly   232 PSVHIRVSDHIKWI 245
            |||:..|:...:||
  Fly   365 PSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 59/265 (22%)
Tryp_SPc 26..248 CDD:304450 61/265 (23%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 59/255 (23%)
Tryp_SPc 138..378 CDD:214473 57/253 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.