DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG4650

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:258 Identity:46/258 - (17%)
Similarity:92/258 - (35%) Gaps:61/258 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KLSPRIAGGYRA--KTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVHLA 83
            |::..|:..:.|  .|..::|:.|               ||:|:.:.:||.....:.|  |..:|
  Fly    35 KIANNISSPWMAYLHTSELLYVCG---------------GTVITEKLVLTAAHCTRAS--EQLVA 82

  Fly    84 SRRSYRGFD-----IIRIYKENFRFHYD--------NDHVIALVKCPYQKFDRRMDRVRVPAYDT 135
            ....:.|.|     ::..|:.:..|.:.        ||  ||::.........:..|.....:.|
  Fly    83 RIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSAND--IAILGLATDIVFSKTIRPICIVWWT 145

  Fly   136 RFERYVGNMTMVCGYGTEKRHAKLPEW-----------MRCIEVEVMNNTECAKYY-TPLKWYEM 188
            .:.:|:.|:.::.|          .:|           .|..::.......|:... |.:...:.
  Fly   146 IWRKYIDNIQVLSG----------AQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQF 200

  Fly   189 CTSGEGFKGVCEGDIG---GAVVTMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248
            | :|:....:|..|..   ||::|......:: :|.:...|......||:..|..|..:|..|
  Fly   201 C-AGDSDSKLCNVDFSSPLGAIITFKNIQRYV-LIGIATTNQKCKRASVYTDVLSHTDFILSV 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 43/249 (17%)
Tryp_SPc 26..248 CDD:304450 44/251 (18%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 44/253 (17%)
Tryp_SPc 33..258 CDD:304450 44/253 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436397
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.