DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:277 Identity:75/277 - (27%)
Similarity:133/277 - (48%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVTLLVLSLTVS-----------VGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLN 54
            ||:.|.|.:....||           :.:..|::.||..||.|......|.||:.:      |.|
  Fly     1 MKVFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGF------SGN 59

  Fly    55 YG---AGTIISNQWILTVKTVLK-YSYIEVHL-ASRRSYRGF-------DIIRIYKENFRFHYDN 107
            .|   .|:||::.|:||...... .|.:.::. |:.|:...|       |.|    :|..:...|
  Fly    60 GGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTHTVGSGDFI----QNHNWPNQN 120

  Fly   108 DHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMN 172
            .:.|||::.|:..|...:::|.:|:::.|:..|.....:.||:|.....:: |:||.|:::::::
  Fly   121 GNDIALIRTPHVDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAGSQ-PDWMECVDLQIIS 184

  Fly   173 NTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGII-WLMPENCSIGYPSVHI 236
            |:||::.|.......:|.|..|.|..|.||.||.:| :......:|:. |:....|:.|.||...
  Fly   185 NSECSRTYGTQPDGILCVSTSGGKSTCSGDSGGPLV-LHDGGRLVGVTSWVSGNGCTAGLPSGFT 248

  Fly   237 RVSDHIKWIKRVSGVGF 253
            ||::.:.||:..|||.:
  Fly   249 RVTNQLDWIRDNSGVAY 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 63/232 (27%)
Tryp_SPc 26..248 CDD:304450 64/234 (27%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 63/232 (27%)
Tryp_SPc 37..260 CDD:238113 64/234 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.