DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG31205

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:246 Identity:42/246 - (17%)
Similarity:74/246 - (30%) Gaps:104/246 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 LVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVH--LASRRSYRGFDIIRIYKE--- 99
            :.|:|:..|.:|::|.                   .|.:.||  .:.|:......||.:.||   
  Fly    93 IYGVVFGDSDSSNINL-------------------VSAVTVHPDYSPRKFENDLAIIELTKEVVF 138

  Fly   100 ----------------------NFRFHYDNDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVG 142
                                  |.:.      ::|.::.|  .||||....:  ..|.|.:.   
  Fly   139 SDLVQPICLPSVSEMVPGSETSNSKL------IVAGLEGP--SFDRRHSATQ--RLDKRIKM--- 190

  Fly   143 NMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAV 207
            ..|.:......::.|:.||.:.|      .:||    .:||.                   |.|:
  Fly   191 TYTKIDSKECHEKQARFPEELIC------GHTE----RSPLS-------------------GSAL 226

  Fly   208 VTMGPNPT---FIGIIWLMPENCSIGYPSV------HIRVSDHIKWIKRVS 249
            ......|.   .:||       ...|:.|.      ::.:..|:.||.:.|
  Fly   227 TEASGTPRQFHLLGI-------AVAGFFSSDLDHQGYLNIRPHLDWISKNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 39/240 (16%)
Tryp_SPc 26..248 CDD:304450 41/243 (17%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 14/99 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.