DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and spirit

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:303 Identity:59/303 - (19%)
Similarity:106/303 - (34%) Gaps:97/303 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVTLLVLSLTVSVGEKNKLSP---------RIAGGY--RAKTFTIIYLVG-------IVYFKSQT 50
            |..::..|...:..|.||:|.         .:.||.  |.:.|..:..:|       .:|::.  
  Fly   101 VAPIVTRSSQQACNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRSNFDQRIYYRC-- 163

  Fly    51 SSLNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDI-------IRIYKENFR------ 102
                  .|.:|:|.::||.          .|.|        |:       :|:..:|..      
  Fly   164 ------GGALIANNFVLTA----------AHCA--------DLGGEPPSQVRLGGDNLTLTEGED 204

  Fly   103 -------FHYD-------NDHVIALVKC-----PYQKFDRRMDRVRVPAYDTRFERYVGNMTMVC 148
                   .|.|       ||  |||::.     |..|          |......:.....:....
  Fly   205 ISIRRVIIHPDYSASTAYND--IALLELETAAKPELK----------PTCIWTQKEVTNTLVTAI 257

  Fly   149 GYGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTP------LKWYEMCTSGE--GFKGVCEGDIGG 205
            |||...........:..:.::.::|.||..:|..      :...:|| :|:  |.:..|:||.||
  Fly   258 GYGQTSFAGLSSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMC-AGDITGERDTCQGDSGG 321

  Fly   206 AVVTMGPNPTFIGIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248
            .::.......::..|..:.:.|:.|.|||:.|||..:.||:.:
  Fly   322 PLLMQDGLLGYVVGITSLGQGCASGPPSVYTRVSSFVDWIEGI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 51/268 (19%)
Tryp_SPc 26..248 CDD:304450 53/270 (20%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 53/270 (20%)
Tryp_SPc 132..361 CDD:214473 51/267 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437051
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.