DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG11664

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:236 Identity:46/236 - (19%)
Similarity:80/236 - (33%) Gaps:75/236 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYG------------AGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYD 106
            |||            ||::.|.:::|||....|.:.....|:.|..||.          ..:.:.
  Fly    33 NYGYVMQIYGPQFLAAGSLFSARYVLTVAHCFKKNTKPEELSVRAGYRW----------IAWEFR 87

  Fly   107 NDHVIALVKCPYQKF-------DRRMDRVRVPAYDTRFERYVGNMTMVCG--------------- 149
            ...|..|::.|  ||       |..:.||:.....:....|:|    :|.               
  Fly    88 GKQVAGLLRHP--KFSPLTLRNDIAVLRVKAAISHSHMINYIG----LCSRPLTPLNMFAPPQEL 146

  Fly   150 YGTEKRHAKLPEWMRCIEVEVMNNTECAKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNP 214
            .|....|...|  ::.:.|:|.....|.:::..:....:|.|....:|:|.||.|..:::.|   
  Fly   147 AGWNLMHIAQP--LKSMSVQVEPEKNCRQWFPQISGGVICASATMGEGLCYGDSGDPLISGG--- 206

  Fly   215 TFIGIIWLMPENCSIG----------YPSVHIRVSDHIKWI 245
                      |.|.:.          ||::...|..|..:|
  Fly   207 ----------EVCGLAIAFRKCGDKRYPALFTDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 45/234 (19%)
Tryp_SPc 26..248 CDD:304450 46/236 (19%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 43/231 (19%)
Tryp_SPc 38..237 CDD:214473 42/229 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.