DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and Mcpt2

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_742041.1 Gene:Mcpt2 / 29266 RGDID:621058 Length:247 Species:Rattus norvegicus


Alignment Length:265 Identity:60/265 - (22%)
Similarity:105/265 - (39%) Gaps:40/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVTLLVLSLTVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQW 65
            |:.::.|:.|.|....|     :..|.||..:...:..|:..:.....:...:..| |.:||.|:
  Rat     1 MQALLFLMALLLPSGAG-----AEEIIGGVESIPHSRPYMAHLDIVTEKGLRVICG-GFLISRQF 59

  Fly    66 ILTVKTVLKYSYIEVHLAS---RRSYRGFDIIRIYKENFRFHYD---NDHVIALVKCPYQKFDRR 124
            :||. ...|...|.|.|.:   |:.......|::.|:.....|:   |.|.|.|:     |.:::
  Rat    60 VLTA-AHCKGREITVILGAHDVRKRESTQQKIKVEKQIIHESYNSVPNLHDIMLL-----KLEKK 118

  Fly   125 MDRVR----VPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIEVEVMNNTECAKY-YTPLK 184
            ::...    ||........:.|.|....|:|...........:|.:|:.:|:...|..| |...|
  Rat   119 VELTPAVNVVPLPSPSDFIHPGAMCWAAGWGKTGVRDPTSYTLREVELRIMDEKACVDYRYYEYK 183

  Fly   185 WYEMCT-SGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGY-----PSVHIRVSDHIK 243
             :::|. |....:....||.||.::..|   ...||:       |.|:     |::..|||.::.
  Rat   184 -FQVCVGSPTTLRAAFMGDSGGPLLCAG---VAHGIV-------SYGHPDAKPPAIFTRVSTYVP 237

  Fly   244 WIKRV 248
            ||..|
  Rat   238 WINAV 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 52/236 (22%)
Tryp_SPc 26..248 CDD:304450 54/238 (23%)
Mcpt2NP_742041.1 Tryp_SPc 20..239 CDD:214473 52/236 (22%)
Tryp_SPc 21..242 CDD:238113 54/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.