DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG18636

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_995714.2 Gene:CG18636 / 2768923 FlyBaseID:FBgn0032551 Length:349 Species:Drosophila melanogaster


Alignment Length:255 Identity:59/255 - (23%)
Similarity:105/255 - (41%) Gaps:36/255 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYI-EVHL 82
            :::.:.||..|:.||..:..::|    |...|:.:....|::|:::.:||.    .:.:| ..||
  Fly    38 QSRTAYRIINGHTAKYNSSPWMV----FLHSTTDMFVCGGSLITDKLVLTA----AHCFIANQHL 94

  Fly    83 ASR-------RS------YRGFDIIRIYKENFRFH-YD-NDHV--IALVKCPYQKFDRRMDRVRV 130
            .:|       ||      |..|....:....|:.. || |.|.  ||:::.......|...|...
  Fly    95 VARLGEYERTRSEECTGYYCNFREEHMVDAGFKHKLYDPNTHANDIAILRLSKSVVYRDNIRPIC 159

  Fly   131 PAYDTRFERYVGNMTMVCGYGTEKRHAKL-PEWMRCIEVEVMNNTECAKYY-TPLKWYEMCTSGE 193
            ..:|.|:..|:..:.::...|..|...:. .:.::.:::.......|||:. ..:...:.| :|.
  Fly   160 VVWDHRWRHYLDKIDLLTATGWGKTQMESDSDALQTLDIRRQPPDVCAKFIGQTIAGNQFC-AGN 223

  Fly   194 GFKGVCEGDIG---GAVVTMGPNPTF--IGIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248
            ....:|.||.|   |||:|......|  :||......||.  ..||...|..|.::|.||
  Fly   224 WDSNLCNGDSGGPLGAVITHKNTQRFVQVGIASYTNRNCQ--KASVFTDVLSHAEFILRV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/244 (23%)
Tryp_SPc 26..248 CDD:304450 56/246 (23%)
CG18636NP_995714.2 Tryp_SPc 44..278 CDD:214473 56/244 (23%)
Tryp_SPc 45..278 CDD:238113 55/243 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436396
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.