DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG33461

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_995843.3 Gene:CG33461 / 2768840 FlyBaseID:FBgn0053461 Length:287 Species:Drosophila melanogaster


Alignment Length:318 Identity:68/318 - (21%)
Similarity:109/318 - (34%) Gaps:112/318 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVTLLVL-----------SLTVSVGEKNKLSPRIAGGYRAKTFT---IIYLVGIVYFKSQTS 51
            ||.::..|.|           .|..:.|...:||.:|..|..|:...   :.:|....||..   
  Fly     6 MKTIIAYLALFVLGVHGSSSVFLEENCGVVPRLSYKIINGTPARLGRYPWMAFLHTPTYFLC--- 67

  Fly    52 SLNYGAGTIISNQW-ILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDNDHVIALVK 115
                 ||::| ||| :||....::   .:|.|.:|..           ||.|   |||     :.
  Fly    68 -----AGSLI-NQWFVLTSAHCIE---DDVELIARLG-----------ENNR---DND-----ID 104

  Fly   116 CPYQK-------------FDRRMDRVRVPAYD----------TRFER---YVGNMTMVCGYGTEK 154
            |...:             |..|:       ||          .|.||   |..::..:|.:...:
  Fly   105 CENNRCLEATQEYNVDMLFKHRL-------YDPKDFSNDIGMLRLERRVEYTYHIQPICIFHHRR 162

  Fly   155 RHAKLPE--WMRCIEVEVMN---NTECAKYYTPLKWY------------------EMCTSGEGFK 196
            ....:.:  |.:.....:.:   ||:.::....|..|                  ::| :|....
  Fly   163 MQLVVDQITWFKATGWGLTSTDLNTKSSRVLMELNLYRRPRNDCARIFKQNFLSGQIC-AGNDDG 226

  Fly   197 GVCEGDIGGA----VVTMGPNPTFI--GIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248
            .:|.||.||.    |:..|.. .|:  ||.....||||  ..|:...|..:.:|||:|
  Fly   227 NLCRGDSGGPQGRYVLIFGMK-RFVQMGIASFTYENCS--KVSILTDVVRYGRWIKKV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/278 (20%)
Tryp_SPc 26..248 CDD:304450 59/280 (21%)
CG33461NP_995843.3 Tryp_SPc 41..278 CDD:214473 56/278 (20%)
Tryp_SPc 42..281 CDD:238113 59/280 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.