DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and Sp212

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:161 Identity:34/161 - (21%)
Similarity:61/161 - (37%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 NFRFHYDNDHVIALVKCPYQKFDRRMDRVRVP--AYDTRFERYVGNMTMVCGYGTEKRHAKLPEW 162
            |.|.:.|.|..:..::.|....|     :..|  .:.....|.|.....:.|:|.::..:: .::
  Fly   363 NTRSYSDADIALITIERPVTFND-----IIAPICMWTVEASRTVSTTGFIAGWGRDEDSSR-TQY 421

  Fly   163 MRCIEVEVMNNTECAKYY--TPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLM-- 223
            .|.:|.|:.:.|.||..:  |.:....:|.......|.|.||.||.::...      |..||:  
  Fly   422 PRVVEAEIASPTVCASTWRGTMVTERSLCAGNRDGSGPCVGDSGGGLMVKQ------GDRWLLRG 480

  Fly   224 ---------PENCSIGYPSVHIRVSDHIKWI 245
                     ...|.:....::..:|.||.||
  Fly   481 IVSAGERGPAGTCQLNQYVLYCDLSKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 32/159 (20%)
Tryp_SPc 26..248 CDD:304450 34/161 (21%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 34/161 (21%)
Tryp_SPc 277..511 CDD:214473 32/159 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436889
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.