DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG30082

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:281 Identity:59/281 - (20%)
Similarity:106/281 - (37%) Gaps:80/281 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 TVSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSY 77
            |:::...|    ||.||..|...:..:|.    :..:.||| ...||:|:.:::||....| :|:
  Fly    31 TINLPPTN----RIVGGRTADIGSNPWLA----YLHKNSSL-VCTGTLITKRFVLTAAHCL-HSF 85

  Fly    78 IEVHLASRR-------------------SYRGFDIIRIYKENFRF--HYDNDHVIALVK----CP 117
               ||.:.|                   :|..:.:...|...| |  ..|:.:.|.|:|    ..
  Fly    86 ---HLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTF-FGGRQDSRNDIGLLKLNGTVV 146

  Fly   118 YQKFDRRMDRVRVPA---YDTRFERYVGNMTMVCGYGTEKRHAKL-----PEWMRCIEVEVMNNT 174
            |:.|.|.:...|.|.   |.:.:|        ..|:|      |:     ...::.:.:..::.:
  Fly   147 YKLFIRPICLFRDPGQVPYSSTYE--------AAGWG------KIDLINTATVLQTVNLIRLDQS 197

  Fly   175 ECAK-YYTPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTF-----IGIIWLMPENCSIGY-- 231
            :|.: ..|.|.:.:.| :|:.....|.||.||.:.....|...     :||:       |.|:  
  Fly   198 DCERSLRTSLSYGQFC-AGQWRADTCSGDSGGPLSRKMSNGRITRTVQLGIV-------SYGHYL 254

  Fly   232 ---PSVHIRVSDHIKWIKRVS 249
               |.|:..|.....||..::
  Fly   255 CRGPGVYTYVPSFTNWILSIT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 55/263 (21%)
Tryp_SPc 26..248 CDD:304450 56/265 (21%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 55/263 (21%)
Tryp_SPc 40..274 CDD:238113 56/265 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.