DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and Ctrb1

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_036668.1 Gene:Ctrb1 / 24291 RGDID:2444 Length:263 Species:Rattus norvegicus


Alignment Length:220 Identity:56/220 - (25%)
Similarity:94/220 - (42%) Gaps:37/220 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 SSLNYGAGTIISNQWILT-----VKTVLKYSYIEVHLASRRSYRGFD--------IIRIYKE-NF 101
            :..::..|::||..|::|     |||      .:|.:|.... :|.|        |.:::|. .|
  Rat    55 TGFHFCGGSLISEDWVVTAAHCGVKT------SDVVVAGEFD-QGSDEENIQVLKIAQVFKNPKF 112

  Fly   102 R-FHYDNDHVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHA-KLPEWMR 164
            . |...||..:..:..|.| |...:..|.:|..|..|.  .|.:....|:|..|.:| |.||.::
  Rat   113 NMFTVRNDITLLKLATPAQ-FSETVSAVCLPNVDDDFP--PGTVCATTGWGKTKYNALKTPEKLQ 174

  Fly   165 CIEVEVMNNTECAKYYTPLKWYEMCT---SGEGFKGV--CEGDIGGAVVTMGPNP-TFIGIIWLM 223
            ...:.:::..:|.|     .|....|   :..|..||  |.||.||.:|...... |..||:...
  Rat   175 QAALPIVSEADCKK-----SWGSKITDVMTCAGASGVSSCMGDSGGPLVCQKDGVWTLAGIVSWG 234

  Fly   224 PENCSIGYPSVHIRVSDHIKWIKRV 248
            ...||...|:|:.||:..:.|::::
  Rat   235 SGVCSTSTPAVYSRVTALMPWVQQI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 55/215 (26%)
Tryp_SPc 26..248 CDD:304450 56/218 (26%)
Ctrb1NP_036668.1 Tryp_SPc 33..256 CDD:214473 55/215 (26%)
Tryp_SPc 34..259 CDD:238113 56/218 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.