DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and try-3

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:276 Identity:60/276 - (21%)
Similarity:102/276 - (36%) Gaps:79/276 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RIAGG--------YRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVH 81
            ||.||        :.||         :|.:......:..|| |:|.:.|::|.          .|
 Worm    37 RIIGGNSIDDGANWMAK---------LVSYGDNGQGILCGA-TVIDDFWLVTA----------AH 81

  Fly    82 LASRRSYRGFDIIRIYKEN-----------FRFHYDN---DHVIALVKCPYQKFDRRMDRVRVPA 132
            .|.:...|.|..:|..|.|           ....|:|   |:.|||::.........:..|.:..
 Worm    82 CALQLQTRSFVYVREPKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDLSKLGIKPVCLVH 146

  Fly   133 YDTRFERYVGNMTMVCGYG-----TEKRHAKL--PEWMRCIEVEVMNNTECAKYY-------TPL 183
            .|::..:...| .:|.|||     ......||  .:.::...|.::::.:|.|.:       ..:
 Worm   147 DDSKLLKQYKN-GVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKI 210

  Fly   184 KWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTF--IGIIWLMPENCSIG------------YPSV 234
            ..|::| :|....|...||.||.::....|..:  |||       .|.|            :|.|
 Worm   211 TGYQIC-AGAYLHGTAPGDSGGPLLIHKSNGEYVQIGI-------TSYGADGLDGVIDQGKFPGV 267

  Fly   235 HIRVSDHIKWIKRVSG 250
            :.|:|.::.||:.|.|
 Worm   268 YTRISKYVPWIQGVIG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 56/269 (21%)
Tryp_SPc 26..248 CDD:304450 57/271 (21%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 56/269 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.