DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and Klk1b3

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_032719.1 Gene:Klk1b3 / 18050 MGIID:97322 Length:261 Species:Mus musculus


Alignment Length:273 Identity:56/273 - (20%)
Similarity:112/273 - (41%) Gaps:56/273 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LVLSLTVSVGEKNKLSP---RIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTV 69
            |:|.|.:|:|..:...|   ||.||::.:..:..:.|.:..:.....     .|.::...|:||.
Mouse     4 LILFLALSLGGIDAAPPVQSRIVGGFKCEKNSQPWHVAVYRYTQYLC-----GGVLLDPNWVLTA 63

  Fly    70 KTVLKYSYIEVHLASRRSYR-----------------GFDIIRIYKENFRF---HYDNDHVIALV 114
            ......:| :|.|.....::                 ||: :.:.:::.||   .|.||.::..:
Mouse    64 AHCYDDNY-KVWLGKNNLFKDEPSAQHRFVSKAIPHPGFN-MSLMRKHIRFLEYDYSNDLMLLRL 126

  Fly   115 KCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGT-EKRHAKLPEWMRCIEVEVMNNTECAK 178
            ..|....| .:..:.:|..:.:    :|:..:..|:|: .....:..:.:.|:.::::.|.:|||
Mouse   127 SKPADITD-TVKPITLPTEEPK----LGSTCLASGWGSITPTKFQFTDDLYCVNLKLLPNEDCAK 186

  Fly   179 YYTPLKWYEMCTSGE--GFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPENCSIGY--------PS 233
            .:.......|..:||  |.|..|:||.||.::..|   ...||       .|.|:        |.
Mouse   187 AHIEKVTDAMLCAGEMDGGKDTCKGDSGGPLICDG---VLQGI-------TSWGHTPCGEPDMPG 241

  Fly   234 VHIRVSDHIKWIK 246
            |:.:::....|||
Mouse   242 VYTKLNKFTSWIK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 47/250 (19%)
Tryp_SPc 26..248 CDD:304450 49/252 (19%)
Klk1b3NP_032719.1 Tryp_SPc 25..256 CDD:238113 49/252 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.