DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and Hgf

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001276387.1 Gene:Hgf / 15234 MGIID:96079 Length:728 Species:Mus musculus


Alignment Length:259 Identity:53/259 - (20%)
Similarity:109/259 - (42%) Gaps:46/259 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VSVGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYI 78
            :|..:..:|  |:..|...:| |:.::|.:.|     .:.:...|::|...|:||.:        
Mouse   486 ISCAKTKQL--RVVNGIPTQT-TVGWMVSLKY-----RNKHICGGSLIKESWVLTAR-------- 534

  Fly    79 EVHLASRRSYRGFDI-IRIYKENFRFHYDNDHVIALVKCPY--QKFDRRMDRVRVPAYDTRFERY 140
            :...|..:..:.::. :.|:..:.|.......::.:.:..|  :..|..:.::..||.   .:.:
Mouse   535 QCFPARNKDLKDYEAWLGIHDVHERGEEKRKQILNISQLVYGPEGSDLVLLKLARPAI---LDNF 596

  Fly   141 VGNMTMVCGYG---TEKRHAKLPEW-----------MRCIEVEVMNNTECAKYY---TPLKWYEM 188
            |..:.:. .||   .||....:..|           :|...:.:|.|.:|::::   ..|...|:
Mouse   597 VSTIDLP-SYGCTIPEKTTCSIYGWGYTGLINADGLLRVAHLYIMGNEKCSQHHQGKVTLNESEL 660

  Fly   189 CTSGEGF-KGVCEGDIGGAVVTMGPNPTFI-GIIWLMP-ENCSI-GYPSVHIRVSDHIKWIKRV 248
            |...|.. .|.||||.||.::........: |:|  :| ..|:| ..|.:.:||:.:.|||.:|
Mouse   661 CAGAEKIGSGPCEGDYGGPLICEQHKMRMVLGVI--VPGRGCAIPNRPGIFVRVAYYAKWIHKV 722

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 48/243 (20%)
Tryp_SPc 26..248 CDD:304450 49/245 (20%)
HgfNP_001276387.1 PAN_APPLE 41..123 CDD:238074
KR 127..209 CDD:214527
KR 211..289 CDD:214527
KR 305..385 CDD:214527
KR 389..471 CDD:238056
Tryp_SPc 495..719 CDD:214473 48/243 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.