DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CTRL

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:291 Identity:60/291 - (20%)
Similarity:110/291 - (37%) Gaps:80/291 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVLSLTVS--------------VGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGA 57
            :|:||||:|              :......|.||..|..|...:..:.|.:    ..:|..::..
Human     1 MLLLSLTLSLVLLGSSWGCGIPAIKPALSFSQRIVNGENAVLGSWPWQVSL----QDSSGFHFCG 61

  Fly    58 GTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFH------------------ 104
            |::||..|::|.      ::..|...     |.|.::..|..:....                  
Human    62 GSLISQSWVVTA------AHCNVSPG-----RHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS 115

  Fly   105 --YDNDHVIALVKCPYQKFDRRMDRVRVPAYD-----------TRFERY--VGNMTMVCGYGTEK 154
              .:||..:..:..|.| :..|:..|.:.:.:           |.:.|.  |||:|         
Human   116 TTMNNDVTLLKLASPAQ-YTTRISPVCLASSNEALTEGLTCVTTGWGRLSGVGNVT--------- 170

  Fly   155 RHAKLPEWMRCIEVEVMNNTECAKYY-TPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNP-TFI 217
                 |..::.:.:.::...:|.:|: :.:....:|..|.|... |:||.||.:|....|. ..|
Human   171 -----PAHLQQVALPLVTVNQCRQYWGSSITDSMICAGGAGASS-CQGDSGGPLVCQKGNTWVLI 229

  Fly   218 GIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248
            ||:....:||::..|:|:.|||....||.:|
Human   230 GIVSWGTKNCNVRAPAVYTRVSKFSTWINQV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 50/254 (20%)
Tryp_SPc 26..248 CDD:304450 51/256 (20%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 51/256 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.