DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG43336

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:288 Identity:70/288 - (24%)
Similarity:115/288 - (39%) Gaps:54/288 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLVVTLLVLSLTVSVGEKNKL---------SPRIAGGYRAKTFTIIYLVGIVY--FKSQTSSLN 54
            |.:||..|...|...:|....|         ||.:.   |.|..|:..|....:  |...|....
  Fly     1 MNVVVVGLTFFLLPLLGSTQFLDMACGIRAHSPSVP---RVKNGTVASLTSSPWMAFLHSTDGRF 62

  Fly    55 YGAGTIISNQWILTV------KTVL-----KYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDND 108
            ...|::|:|:.:||.      :|.|     :|...|..:. ..||..:.|..:.:..||..:.|.
  Fly    63 ICGGSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEMC-HDSYCTYRIEAMVERGFRHRHYNP 126

  Fly   109 ----HVIALVKCPYQKFDRRMDRVRVP---AYDTRFERYVGNMTMVCGYG-----TEKRHAKLPE 161
                :.||:::. |:|. :..|.:| |   ..|.|:.:|:.::..:.|.|     :|...|||  
  Fly   127 MTMAYDIAILRL-YRKV-QYTDNIR-PICIVIDPRWRKYIDSLDPLTGTGWGKTESEGDSAKL-- 186

  Fly   162 WMRCIEVEVMNNTECAKYYT-PLKWYEMCTSGEGFKGVCEGDIG---GAVVTMGPNPTF--IGII 220
              |.:::...:...|.:|.| .|...:.|...|. ..:|.||.|   ||::..|.:..|  :||.
  Fly   187 --RTVDLARKHPEVCRRYATLSLTANQFCAGNER-SNLCNGDSGGPVGALIPYGKSKRFVQVGIA 248

  Fly   221 WLMPENCSIGYPSVHIRVSDHIKWIKRV 248
            ......|.:  .||...|..::.||..|
  Fly   249 SFTNTQCVM--VSVFTDVMSYVDWILAV 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 58/250 (23%)
Tryp_SPc 26..248 CDD:304450 60/252 (24%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 58/244 (24%)
Tryp_SPc 40..271 CDD:238113 56/241 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436399
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.