DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG43110

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:256 Identity:62/256 - (24%)
Similarity:93/256 - (36%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSY 88
            |:|..|..|...:..|:.||.    .|:.|..| ||||...::|||........:.|.|.:....
  Fly    34 PKIISGSNASQQSAQYMAGIF----NTTHLLCG-GTIIHEDFVLTVAHCKSTQTLFVRLGAYNIN 93

  Fly    89 RGFDIIRIYKENFRFHYDND---HVIALVKCPYQKFDRRMDRVRVPAYDTRFERYV---GNMTMV 147
            ...|.||:.:......|.|.   :.|||||                     .||.|   .|:..:
  Fly    94 HPTDQIRVIETIAHPQYSNSTYANDIALVK---------------------LERSVIFNLNIQPI 137

  Fly   148 C-----------------GYGTEKRHAKLPEWMRCIEVEVMNNTECAKY--YTPLKWYEMCTSGE 193
            |                 |:| ..|:|:..:.::.|.|...|...|..|  .:|.......|:.:
  Fly   138 CIHLDATLGKQIRYYNAFGWG-RTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTDQ 201

  Fly   194 GFKGVCEGDIGGAVVT----MGPN-PTFIGIIWLMPENCS-IGYPSVHIRVSDHIKWIKRV 248
            |  ..|.||.||.:::    .|.| .|..||.......|: :|   ::..||.:..||..:
  Fly   202 G--DTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVG---LYTDVSQYSGWIANI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 59/250 (24%)
Tryp_SPc 26..248 CDD:304450 61/252 (24%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 59/250 (24%)
Tryp_SPc 36..257 CDD:238113 61/252 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436412
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.