DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG43125

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:239 Identity:44/239 - (18%)
Similarity:82/239 - (34%) Gaps:74/239 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IVYFKSQTSSLNYGAGTIISNQWILTVKTVLKYSYIEVHLASRRSYRGFDIIRIYKENFRFHYDN 107
            :|..:.:.||.....||:|:.:::||..:.:.|   :..|..|..    :|....:.:.:..|:.
  Fly    39 LVKIRPELSSNITCTGTLINERFVLTAASCIDY---QTELIVRLG----EIDGTLQNSSKLQYEE 96

  Fly   108 DHVI-ALVKCPY----QKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIE 167
            .:|. ||:...|    .:::..:.|::....      |..|:..:|   .:....|:|: ....|
  Fly    97 IYVARALIHRSYSSESHQYNIALLRLKTSVV------YKKNIQPIC---IDVNVGKVPK-APTFE 151

  Fly   168 VEVMNNTECAKYYTP-----LKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIGIIWLMPENC 227
            :|...|.|..|....     |.|:      ....||.|           |.|..|    |.|:..
  Fly   152 IEKKKNEEPKKNKAGIMKRFLNWF------LSLFGVRE-----------PRPDVI----LPPQPI 195

  Fly   228 SIGYP--------------------------SVHIRVSDHIKWI 245
            ::|:|                          .|:..|..::.||
  Fly   196 AVGWPLTKQINESALFHQYGILSHRNSESKKDVYTDVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 42/237 (18%)
Tryp_SPc 26..248 CDD:304450 44/239 (18%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 21/113 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436413
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.