DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and Ctrl

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:293 Identity:60/293 - (20%)
Similarity:107/293 - (36%) Gaps:84/293 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLVLSLTVS--------------VGEKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQTSSLNYGA 57
            :|:||||:|              :......:.||..|..|...:..:.|.:    ...:..::..
Mouse     1 MLLLSLTLSLVLLGSSWGCGVPAITPALSYNQRIVNGENAVPGSWPWQVSL----QDNTGFHFCG 61

  Fly    58 GTIISNQWILTVKTVLKYSYIEV----HLASRRSY---------RGFDIIR-IYKENFRFHYDND 108
            |::||..|::|.      ::.:|    |......|         :...|.| |...|:..:..|:
Mouse    62 GSLISPNWVVTA------AHCQVTPGRHFVVLGEYDRSSNAEPVQVLSIARAITHPNWNANTMNN 120

  Fly   109 HVIALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRHAKLPEWMRCIE------ 167
            .:..|             ::..||      ||...::.||...|.:   .||..:.|:.      
Mouse   121 DLTLL-------------KLASPA------RYTAQVSPVCLASTNE---ALPSGLTCVTTGWGRI 163

  Fly   168 ---------------VEVMNNTECAKYY-TPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNP-T 215
                           :.::...:|.:|: ..:....:|..|.|... |:||.||.:|....|. .
Mouse   164 SGVGNVTPARLQQVVLPLVTVNQCRQYWGARITDAMICAGGSGASS-CQGDSGGPLVCQKGNTWV 227

  Fly   216 FIGIIWLMPENCSIGYPSVHIRVSDHIKWIKRV 248
            .|||:....:||:|..|:::.|||....||.:|
Mouse   228 LIGIVSWGTKNCNIQAPAMYTRVSKFSTWINQV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 51/256 (20%)
Tryp_SPc 26..248 CDD:304450 52/258 (20%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 51/256 (20%)
Tryp_SPc 34..260 CDD:238113 52/258 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.