DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sphinx1 and CG42694

DIOPT Version :9

Sequence 1:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:225 Identity:52/225 - (23%)
Similarity:84/225 - (37%) Gaps:50/225 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NY-GAGTIISNQWILTVKTVLKYSYIEVHL---ASRRSYRGFDIIRIYKE-NFRFHYDNDHVIAL 113
            || |.|..|::::::|....|..|...:::   .:.|||..|.:..::|. .|...|.||  |||
  Fly   311 NYIGQGWFITHRFVITNAKDLPESAESLYVGLPGTLRSYDEFSVQSVFKHPEFSEDYKND--IAL 373

  Fly   114 VKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKRH--AKLPEWMRCIEVEVMNNTEC 176
            :        |...||.           :|::..:|....|.:.  ||....:....|:..|..:.
  Fly   374 L--------RVHQRVA-----------MGHLRPICMLLKENQQELAKSSPPISFDYVQTANRIQV 419

  Fly   177 AKYYTPLKWYEMCTSGEGFKGVCEGDIGGAVV----TMGPNPTFIGII----------WLMPENC 227
            .:....|....:||: ...|.:....:  .||    |:..|.|..||:          ||:....
  Fly   420 VRKIDALADPRICTN-RLLKTIEPNQL--CVVVPPETVQKNATRGGILGLRMMYSGKEWLILFGI 481

  Fly   228 SIGYP----SVHIRVSDHIKWIKRVSGVGF 253
            | .|.    .|...|.:|.:||..|....|
  Fly   482 S-SYSHNDIEVFTNVMEHTQWIANVVNSDF 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 48/215 (22%)
Tryp_SPc 26..248 CDD:304450 50/218 (23%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450
Tryp_SPc 46..253 CDD:214473
Tryp_SPc 319..505 CDD:304450 46/210 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.