DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32376 and alphaTry

DIOPT Version :9

Sequence 1:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:221 Identity:80/221 - (36%)
Similarity:112/221 - (50%) Gaps:2/221 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 RIVNGKRIPCTEAPFQGSLHYEGYFVCGCVIINKIWILTAHHCFFG-PPEKYTVRVGSDQQRRGG 128
            |||.|.....:..|:|.||...|...||..|.:...|:||.||... ......||.||.....||
  Fly    30 RIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSGG 94

  Fly   129 QLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPSTKTTKFPKKFVVSGWGITSA 193
            .:..|........||..||.:|:|:::|.|.:.|...::.:.| :|..........|||||..|:
  Fly    95 VVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISL-ATYNPANGASAAVSGWGTQSS 158

  Fly   194 NAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICASRTNKDSCSGDSGGPLTSRGVLYGI 258
            .:.::...|:.|.::.:.:|:|.......|.:|...||||:.:.||:|.|||||||.|.|||.|:
  Fly   159 GSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASGKDACQGDSGGPLVSGGVLVGV 223

  Fly   259 VSWGIGCANKNYPGVYVNCKRYVPWI 284
            ||||.|||..||||||.:......|:
  Fly   224 VSWGYGCAYSNYPGVYADVAVLRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 79/219 (36%)
Tryp_SPc 66..287 CDD:238113 79/220 (36%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 79/219 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
43.910

Return to query results.
Submit another query.