DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32376 and KLKB1

DIOPT Version :10

Sequence 1:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_011530232.1 Gene:KLKB1 / 3818 HGNCID:6371 Length:649 Species:Homo sapiens


Alignment Length:236 Identity:82/236 - (34%)
Similarity:120/236 - (50%) Gaps:18/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TRIVNGKRIPCTEAPFQGSLHYE---GYFVCGCVIINKIWILTAHHCFFGPPEKYTVRVGS---- 121
            ||||.|......|.|:|.||..:   ...:||..:|...|:|||.|||.|.|.:...|:.|    
Human   400 TRIVGGTNSSWGEWPWQVSLQVKLTAQRHLCGGSLIGHQWVLTAAHCFDGLPLQDVWRIYSGILN 464

  Fly   122 -DQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKLKSPVYFGKCVRPVKLPST-KTTKFPKKFV 184
             ....:......:|:|:....|......||:|::||::|:.:.:..:|:.|||. .|:.......
Human   465 LSDITKDTPFSQIKEIIIHQNYKVSEGNHDIALIKLQAPLNYTEFQKPICLPSKGDTSTIYTNCW 529

  Fly   185 VSGWGITSANAQNVQRYLRRVQIDYIKRSKCQKMYKKAGLKIYKDMICA--SRTNKDSCSGDSGG 247
            |:|||.:....: :|..|::|.|..:...:|||.|:  ..||.:.|:||  ....||:|.|||||
Human   530 VTGWGFSKEKGE-IQNILQKVNIPLVTNEECQKRYQ--DYKITQRMVCAGYKEGGKDACKGDSGG 591

  Fly   248 PLTSR--GV--LYGIVSWGIGCANKNYPGVYVNCKRYVPWI 284
            ||..:  |:  |.||.|||.|||.:..||||.....|:.||
Human   592 PLVCKHNGMWRLVGITSWGEGCARREQPGVYTKVAEYMDWI 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 79/233 (34%)
KLKB1XP_011530232.1 APPLE 21..104 CDD:128519
APPLE 111..194 CDD:128519
APPLE 212..295 CDD:128519
APPLE 303..386 CDD:128519
Tryp_SPc 402..632 CDD:238113 78/232 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.