powered by:
Protein Alignment CG32376 and LOC1269074
DIOPT Version :10
| Sequence 1: | NP_729271.1 |
Gene: | CG32376 / 318002 |
FlyBaseID: | FBgn0052376 |
Length: | 291 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_061514456.1 |
Gene: | LOC1269074 / 1269074 |
VectorBaseID: | AGAMI1_009123 |
Length: | 278 |
Species: | Anopheles gambiae |
| Alignment Length: | 73 |
Identity: | 17/73 - (23%) |
| Similarity: | 27/73 - (36%) |
Gaps: | 26/73 - (35%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 SLPNSFLQISPCVPSLQLRKPVMAAVKGGKQSVRRSSNTVVQITCRKKELHPEFHEDAKVYCNGE 68
::|...||:|..: |:|.::. |:|.:.|.. ||.|.|.|.|
Mosquito 34 AIPTDGLQLSDFI----------------KESTKKQ---------RQKAIIPSI-EDTKEYLNPE 72
Fly 69 LVMTTGGT 76
.:...|.|
Mosquito 73 DLQGNGRT 80
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| CG32376 | NP_729271.1 |
Tryp_SPc |
65..284 |
CDD:214473 |
4/12 (33%) |
| LOC1269074 | XP_061514456.1 |
None |
Return to query results.
Submit another query.
