DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32376 and hgf

DIOPT Version :10

Sequence 1:NP_729271.1 Gene:CG32376 / 318002 FlyBaseID:FBgn0052376 Length:291 Species:Drosophila melanogaster
Sequence 2:XP_002933142.2 Gene:hgf / 100495840 XenbaseID:XB-GENE-999992 Length:710 Species:Xenopus tropicalis


Alignment Length:273 Identity:75/273 - (27%)
Similarity:108/273 - (39%) Gaps:45/273 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TPNFGNISSNPFINALEAQESFPTRIVNGKRIPC-TEAPFQGSLHYEGYFVCGCVIINKIWILTA 104
            |....||.|     .:....|...|:|||  ||. |...:..|:.|.....||..:|.:.|:|||
 Frog   458 TKIMANIDS-----PITCSSSKQLRVVNG--IPTQTRKVWMVSVRYRNSHKCGGTLIKENWVLTA 515

  Fly   105 HHCF-------------FGPPEKYTVRVGSDQQRRGGQLRHVKKIVALAAYNDYTMRHDLAMMKL 156
            ..||             .|....|:......|.....||.|..|            ..:|.::||
 Frog   516 RQCFLSGDNDLKDYEAWLGVHNIYSTTEKHKQVLNISQLVHGPK------------GSNLVLLKL 568

  Fly   157 KSPVYFGKCVRPVKLPSTKTTKFPKKFVVS--GWGITSANAQNVQRYLRRVQIDYIKRSKCQKMY 219
            ..|......|..:|||:...| .|:..:.|  |||.|..|..:.|  |:...:..:...||.: :
 Frog   569 SRPATLNAYVDRIKLPNYGCT-IPENTMCSVYGWGHTGTNDYDGQ--LQEGTLHIVGNEKCNE-H 629

  Fly   220 KKAGLKIYKDMICA-SRT-NKDSCSGDSGGPL----TSRGVLYGIVSWGIGCANKNYPGVYVNCK 278
            .|..:.:.:..||| |.| |...|..|.||||    ....::.|::..|.|||.:..|.::|...
 Frog   630 HKGKITVNESEICAMSETANIGPCERDYGGPLICEENRTHLVQGVIIPGRGCAIQKRPVIFVRVA 694

  Fly   279 RYVPWIKKVIHKY 291
            .|..||.|::..|
 Frog   695 YYAKWIHKIMLTY 707

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32376NP_729271.1 Tryp_SPc 65..284 CDD:214473 66/240 (28%)
hgfXP_002933142.2 PAN_AP_HGF 26..109 CDD:238532
KR 113..195 CDD:214527
KR 197..275 CDD:214527
KR 288..367 CDD:214527
KR 373..454 CDD:238056
Tryp_SPc 478..703 CDD:238113 67/242 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.