Sequence 1: | NP_001261534.1 | Gene: | CG32373 / 318000 | FlyBaseID: | FBgn0052373 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001380459.1 | Gene: | MATN4 / 8785 | HGNCID: | 6910 | Length: | 581 | Species: | Homo sapiens |
Alignment Length: | 196 | Identity: | 55/196 - (28%) |
---|---|---|---|
Similarity: | 74/196 - (37%) | Gaps: | 57/196 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 148 YTLNSTDL----------RSCNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLD 202
Fly 203 IDECADPELSWDCTAGCKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDI 267
Fly 268 NECDLADIDSDSWRMTYRYCEHKCENTVGSYICHCPQGYHLLDDQNSC------------ILDGS 320
Fly 321 K 321 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32373 | NP_001261534.1 | FXa_inhibition | 124..158 | CDD:291342 | 4/19 (21%) |
vWFA | <158..199 | CDD:294047 | 16/40 (40%) | ||
FXa_inhibition | 287..315 | CDD:291342 | 11/27 (41%) | ||
CCP | 340..398 | CDD:153056 | |||
MATN4 | NP_001380459.1 | None | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E33208_3BA2W | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |