DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and MATN4

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001380459.1 Gene:MATN4 / 8785 HGNCID:6910 Length:581 Species:Homo sapiens


Alignment Length:196 Identity:55/196 - (28%)
Similarity:74/196 - (37%) Gaps:57/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YTLNSTDL----------RSCNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLD 202
            :.:.|.||          |.| .||.|.|...||...|.|.||.:.|.|..||.: :.|:::|..
Human   194 FLVESFDLIQEFGLQFQSRLC-AIDLCAEGTHGCEHHCVNSPGSYFCHCQVGFVL-QQDQRSCRA 256

  Fly   203 IDECADPELSWDCTAGCKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDI 267
            ||.|:....|  |...|.:..|..:|                     .|:.|..|..||..||..
Human   257 IDYCSFGNHS--CQHECVSTPGGPRC---------------------HCREGHDLQPDGRSCQVR 298

  Fly   268 NECDLADIDSDSWRMTYRYCEHKCENTVGSYICHCPQGYHLLDDQNSC------------ILDGS 320
            :.|:..|          ..||.:|.:...||.|.||:|..|..|..||            ::|||
Human   299 DLCNGVD----------HGCEFQCVSEGLSYRCLCPEGRQLQADGKSCNRCREGHVDLVLLVDGS 353

  Fly   321 K 321
            |
Human   354 K 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 4/19 (21%)
vWFA <158..199 CDD:294047 16/40 (40%)
FXa_inhibition 287..315 CDD:291342 11/27 (41%)
CCP 340..398 CDD:153056
MATN4NP_001380459.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.