DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and Fbn2

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_114014.2 Gene:Fbn2 / 689008 RGDID:620910 Length:2907 Species:Rattus norvegicus


Alignment Length:399 Identity:116/399 - (29%)
Similarity:161/399 - (40%) Gaps:117/399 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NALYCSNGIWLG--------------LKP---NCIKIGKGNTHSMKQKKMRCRIDNGGCAHICNR 137
            |.|.|..|..:.              |.|   :||.|   |..|:...  .||  ||.|.::.  
  Rat  1158 NPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCIDI---NECSLSDN--LCR--NGKCVNMI-- 1213

  Fly   138 STHKCECYEGYTLNSTDLRSCNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLD 202
            .|::|.|..||.. :.|.:.|:|||||...||||...|.|..|.:.|:|:.|:.: ..|.::|.|
  Rat  1214 GTYQCSCNPGYQA-TPDRQGCSDIDECMIMNGGCDTQCTNSEGSYECSCSEGYAL-MPDGRSCAD 1276

  Fly   203 IDECA-DPELSWDCTAG-CKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQ 265
            ||||. :|::   |..| |.|:.|.|:||                     |..||..|.|...|.
  Rat  1277 IDECENNPDI---CDGGQCTNIPGEYRCL---------------------CYDGFMASMDMRTCI 1317

  Fly   266 DINECDLADIDSDSWRMTYRYCEH-KCENTVGSYICHCPQGYHLLDDQNSCI-LDGSKLPPSKDA 328
            |:|||||          ....|.. :||||.||:||||..||.:......|. :|..::....  
  Rat  1318 DVNECDL----------NPNICMFGECENTKGSFICHCQLGYSVKKGATGCTDVDECEIGAHN-- 1370

  Fly   329 PVSQEAPRKDICPLFKG----PANGKASC-DKYLQNGF---------NYT-RCNITCNAGYI-MQ 377
                       |.:...    |.:.|.|| :.::.||.         |.| :|:|  ||..: ..
  Rat  1371 -----------CDMHASCLNVPGSFKCSCREGWVGNGIKCIDLDECSNGTHQCSI--NAQCVNTP 1422

  Fly   378 GSQFAVC--GHT--GLWSSPEAKCVESLALSCPVLTPPRNGRFYPASCNNEPSKSLAICELLCDR 438
            ||....|  |.|  |...|...:|.|::.| |      .||:     |.|.|....  ||  |:.
  Rat  1423 GSYRCACSEGFTGDGFTCSDVDECAENINL-C------ENGQ-----CLNVPGAYR--CE--CEM 1471

  Fly   439 GYLPRMDTQ 447
            |:.|..|::
  Rat  1472 GFTPASDSR 1480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 11/33 (33%)
vWFA <158..199 CDD:294047 17/40 (43%)
FXa_inhibition 287..315 CDD:291342 13/28 (46%)
CCP 340..398 CDD:153056 20/77 (26%)
Fbn2NP_114014.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.