DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and fbln5

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001005979.1 Gene:fbln5 / 449806 ZFINID:ZDB-GENE-041010-54 Length:477 Species:Danio rerio


Alignment Length:297 Identity:80/297 - (26%)
Similarity:124/297 - (41%) Gaps:82/297 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 CSNGIWLGLKPNCIKIGKGNTHSMKQKKMRCRIDNGGC--AHICNRST--HKCECYEGYTLNSTD 154
            |..|...|....|:.:.:            |..::..|  ..:|..:.  :.|.|.|||.|..  
Zfish   143 CLLGYTFGADGTCVDVDE------------CEAESHQCNPTQVCINTAGGYTCSCTEGYWLVG-- 193

  Fly   155 LRSCNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLDIDEC-ADPELSWDCTAG 218
             ..|.|||||:  .|.|.|:|.|:||.:.|:|:.||.:: :|.:||.|:||| .||     |:.|
Zfish   194 -GQCQDIDECR--YGYCQQLCANVPGSYSCSCSPGFLLN-TDARTCQDVDECVTDP-----CSHG 249

  Fly   219 CKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDINECDLADIDSDSWRMT 283
            |.|..|::.|                     .|..||:|:.|.:.|.|::||..:|.        
Zfish   250 CLNTYGSFMC---------------------TCDEGFELAADDTTCNDLDECSFSDF-------- 285

  Fly   284 YRYCEHKCENTVGSYICHCPQGYHLLDDQNSCILDGSKLPPSKDAPVSQEAPRKDICPLFKGPAN 348
              .|:|.|.|..||:.|.||.||::.:|..|| .|.::.....:...:::     :|..|:|   
Zfish   286 --LCQHTCVNAPGSFSCACPSGYYVYEDGRSC-EDLNECESGNNTCTTEQ-----VCFNFQG--- 339

  Fly   349 GKASCDKYLQNGFNYTRCN-ITCNAGYIMQGSQFAVC 384
                         .||..| :.|:..||.......:|
Zfish   340 -------------GYTCLNPLRCDPPYIELSDNQCMC 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 9/37 (24%)
vWFA <158..199 CDD:294047 18/40 (45%)
FXa_inhibition 287..315 CDD:291342 12/27 (44%)
CCP 340..398 CDD:153056 10/46 (22%)
fbln5NP_001005979.1 vWFA <155..191 CDD:294047 9/47 (19%)
vWFA <191..234 CDD:294047 19/48 (40%)
vWFA <235..273 CDD:294047 18/63 (29%)
vWFA <274..314 CDD:294047 17/49 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
32.870

Return to query results.
Submit another query.