Sequence 1: | NP_001261534.1 | Gene: | CG32373 / 318000 | FlyBaseID: | FBgn0052373 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_610267.2 | Gene: | pwn / 44011 | FlyBaseID: | FBgn0003174 | Length: | 1363 | Species: | Drosophila melanogaster |
Alignment Length: | 321 | Identity: | 65/321 - (20%) |
---|---|---|---|
Similarity: | 100/321 - (31%) | Gaps: | 141/321 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 CIKIGKGNTHSMKQKKMRCRIDNGGCAHIC----NRSTHKCEC---------------YEGYTLN 151
Fly 152 STDLRSCNDIDECKESNGGCS-----------------------QVCN------NLPGEFICTCN 187
Fly 188 SGFEIDESDE---------------------------------------KTCLDIDECADPELSW 213
Fly 214 DCTAG--CKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFK------LSDDGSECQDINEC 270
Fly 271 DLADIDSDSWRMTYRYCEHKCENTVGSYICHCPQGYHLLDDQNSCILDGSKLPPSKDAPVS 331 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32373 | NP_001261534.1 | FXa_inhibition | 124..158 | CDD:291342 | 12/52 (23%) |
vWFA | <158..199 | CDD:294047 | 14/108 (13%) | ||
FXa_inhibition | 287..315 | CDD:291342 | 4/27 (15%) | ||
CCP | 340..398 | CDD:153056 | |||
pwn | NP_610267.2 | EGF_CA | 1026..1075 | CDD:214542 | 18/70 (26%) |
EGF_2 | 1074..1109 | CDD:285248 | 9/50 (18%) | ||
Abhydrolase_9_N | <1124..>1165 | CDD:292062 | 1/2 (50%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR24034 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |