DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and pwn

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_610267.2 Gene:pwn / 44011 FlyBaseID:FBgn0003174 Length:1363 Species:Drosophila melanogaster


Alignment Length:321 Identity:65/321 - (20%)
Similarity:100/321 - (31%) Gaps:141/321 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 CIKIGKGNTHSMKQKKMRCRIDNGGCAHIC----NRSTHKCEC---------------YEGYTLN 151
            || :|..:|....|.: ||:.|||..:..|    :|..|:..|               ||...:.
  Fly   851 CI-VGDDSTCDQAQHE-RCKTDNGVSSCHCRPGYSRRKHREPCRRVISFHLGMRVDRIYEHRIVW 913

  Fly   152 STDLRSCNDIDECKESNGGCS-----------------------QVCN------NLPGEFICTCN 187
            .|.|     :|:..|..|..|                       :|.|      ||.|..:.. |
  Fly   914 DTKL-----MDKHSEPFGQLSYESIRALDSAMSMTPYSDEFMEAKVNNIYRGDPNLGGSGVYV-N 972

  Fly   188 SGFEIDESDE---------------------------------------KTCLDIDECADPELSW 213
            ...::|||.|                                       ....|:|||..|||: 
  Fly   973 MTIKLDESVETLRPNLRSDVQKHLLGVLHRRNNNIGNSVLYVSSPEGAVSALQDLDECQSPELN- 1036

  Fly   214 DCTAG--CKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFK------LSDDGSECQDINEC 270
            ||.:|  |.|..|:::|                     .|::|.:      .:..|.|||   .|
  Fly  1037 DCHSGASCSNTWGSFRC---------------------ACEAGLRDPWADQPARSGRECQ---AC 1077

  Fly   271 DLADIDSDSWRMTYRYCEHKCENTVGSYICHCPQGYHLLDDQNSCILDGSKLPPSKDAPVS 331
                  :||....:..|.:..:   |:.:|.|...::    ...|.:||..|..:..|.|:
  Fly  1078 ------ADSVCNNHGTCSYAED---GAQLCTCDSSHY----GAQCEIDGEVLGVAIGASVA 1125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 12/52 (23%)
vWFA <158..199 CDD:294047 14/108 (13%)
FXa_inhibition 287..315 CDD:291342 4/27 (15%)
CCP 340..398 CDD:153056
pwnNP_610267.2 EGF_CA 1026..1075 CDD:214542 18/70 (26%)
EGF_2 1074..1109 CDD:285248 9/50 (18%)
Abhydrolase_9_N <1124..>1165 CDD:292062 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24034
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.