DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and LTBP3

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_011543334.1 Gene:LTBP3 / 4054 HGNCID:6716 Length:1312 Species:Homo sapiens


Alignment Length:568 Identity:135/568 - (23%)
Similarity:186/568 - (32%) Gaps:251/568 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 WTPPRIKNAKASV-------------KLRRN----GEHVFLVTYYSCRVN--YKLKRAKDNALYC 94
            |..|.:..::::|             :|.:|    ||.|.....|||..|  |   |:.....||
Human   562 WFLPDLPPSRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCHCNPGY---RSHPQHRYC 623

  Fly    95 -------------SNGIWL--GLKPNC-------IKIGKGNTHSMKQKKMRCRIDNGGCA--HIC 135
                         ..||.:  |...||       :.:|.|.         |..:|...||  |:|
Human   624 VDVNECEAEPCGPGRGICMNTGGSYNCHCNRGYRLHVGAGG---------RSCVDLNECAKPHLC 679

  Fly   136 -------NRSTH-KCECYEGYTLNSTDLRSCNDIDECKE-------------------------- 166
                   |...| ||.||.||.|.::....|.|||||::                          
Human   680 GDGGFCINFPGHYKCNCYPGYRLKASRPPVCEDIDECRDPSSCPDGKCENKPGSFKCIACQPGYR 744

  Fly   167 SNGG--CSQV-------------CNNLPGEFICTCNSGFEIDESDEKTCLDIDECADPELSWDCT 216
            |.||  |..|             |.||||.|.|||..|: ....|.::|||:|||...::   |.
Human   745 SQGGGACRDVNECAEGSPCSPGWCENLPGSFRCTCAQGY-APAPDGRSCLDVDECEAGDV---CD 805

  Fly   217 AG-CKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDINECDL--ADIDSD 278
            .| |.|..|:::|                     .|.||:.||.|.|.|:||:|||.  |.|..|
Human   806 NGICSNTPGSFQC---------------------QCLSGYHLSRDRSHCEDIDECDFPAACIGGD 849

  Fly   279 SWRMTYRYCEHKCENTVGSYICHCPQGYHLL------------DDQNSCI-------LDGSKL-- 322
                        |.||.|||.|.||||:.|:            .|.:.|:       |.||.:  
Human   850 ------------CINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPSLCLPHGACKNLQGSYVCV 902

  Fly   323 -----PPSKD----APVSQEAPRK----------------------------------DICPLFK 344
                 .|::|    ..|.|...:|                                  |.|.::.
Human   903 CDEGFTPTQDQHGCEEVEQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYP 967

  Fly   345 GPANGKASCDKYLQNGFNYTRCNITCNAGY---------IMQGSQFAVCGHTGLWSSPEAKCVES 400
            .|....|.......:|..||:.|...|.|.         ::.||:  :|        .|.|||. 
Human   968 CPVYSSAEFHSLCPDGKGYTQDNNIVNYGIPAHRDIDECMLFGSE--IC--------KEGKCVN- 1021

  Fly   401 LALSCPVLTPP------RNGRFYPAS---------CNNEPSKSLAICE 433
                    |.|      :.|.:|..:         |.:|.:....:||
Human  1022 --------TQPGYECYCKQGFYYDGNLLECVDVDECLDESNCRNGVCE 1061

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 14/43 (33%)
vWFA <158..199 CDD:294047 22/81 (27%)
FXa_inhibition 287..315 CDD:291342 13/39 (33%)
CCP 340..398 CDD:153056 14/66 (21%)
LTBP3XP_011543334.1 EGF_CA 364..399 CDD:214542
TB 424..459 CDD:279073
EGF_CA 625..668 CDD:214542 8/51 (16%)
EGF_CA 669..703 CDD:238011 13/33 (39%)
EGF_CA 712..745 CDD:214542 5/32 (16%)
EGF_CA 753..792 CDD:214542 12/39 (31%)
EGF_CA 794..834 CDD:214542 17/63 (27%)
EGF_CA 835..874 CDD:214542 20/50 (40%)
EGF_CA 875..908 CDD:214542 5/32 (16%)
TB 938..975 CDD:279073 3/36 (8%)
EGF_CA 1045..>1073 CDD:214542 4/17 (24%)
EGF_CA 1091..1126 CDD:214542
TB 1157..1190 CDD:279073
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.