DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and frac

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001137905.1 Gene:frac / 38850 FlyBaseID:FBgn0035798 Length:1618 Species:Drosophila melanogaster


Alignment Length:586 Identity:171/586 - (29%)
Similarity:237/586 - (40%) Gaps:206/586 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VLYALMCIAFSTAS---------LNDIPEITPAIDNNLSFQYDDTCWT----PPRIKNAKASV-K 62
            ||.||.|:||::||         :.:||| .|.:.::|:...|.:|.:    ||.|.:.:.|| .
  Fly     7 VLCALACVAFASASPSSERKRKNVMNIPE-DPKVSDSLAASLDMSCSSAKILPPEINHGRVSVFD 70

  Fly    63 LRRNGEHVFLVTYYSCRVNYKLKRAKDNALYCSNGIWLGLKPNCI----------KIG------- 110
            .||.|:.||||.::.|..||..:.. .:.::|||..|:...|.||          |:|       
  Fly    71 RRRRGKKVFLVAFFVCDDNYDFENG-ISEMFCSNQKWVDEIPTCIPQLNFEEHDEKVGYDLEDYS 134

  Fly   111 ----------------------------------------------------------------- 110
                                                                             
  Fly   135 DETVPNDYVENSDIDEDDDEEVSEREPPPPPPPPVVDGADSKPEPQIVIEINDDHANEVVESEPA 199

  Fly   111 --------------------------KGNTHSMKQKK---------MRCRIDNGGCAHIC----- 135
                                      ..:..|:|...         ..|..|||||||||     
  Fly   200 LAETETENEVLENETPLKAEVQTDVLNSSNASVKVTNDPYEPTFLDNNCGEDNGGCAHICKRLLY 264

  Fly   136 ---NRSTHKCECYEGYTLNSTDLRSCNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDE 197
               |:..:||:|.|||||:..|..||.|||||.|||||||::|.|||||:.|:|..|:.:|||. 
  Fly   265 PDENQPINKCDCREGYTLDPNDYASCLDIDECLESNGGCSEICENLPGEYKCSCQEGYYLDESG- 328

  Fly   198 KTCLDIDECADPELSWDCTAGCKNLNGTYKCL------PSLVGRVE---------PTDGDGFSPG 247
            |:|:||:|||:||||.:|...|:||.|:|:|:      |.:...||         |.:.....|.
  Fly   329 KSCVDINECANPELSSNCQGACENLPGSYRCVEPLEENPEITEVVENPIEKTNEVPVNVSESQPA 393

  Fly   248 EIVCKSGFKLSDDGSECQDINECDL---ADIDSDSWRMTYRYCEHKCENTVGSYICHCPQGYHLL 309
            ...|.|||:||.||::|||||||::   .|:|:::      .|:.|||||:||:.|.|.:|||||
  Fly   394 GKTCNSGFQLSADGTDCQDINECEVDGPEDLDNNA------VCQQKCENTIGSFRCTCVEGYHLL 452

  Fly   310 DDQNSCILDGSKLPPSKDAPVSQEAPRKDICPLFKGPANGKASCDKYLQNGFNYTRCNITCNAGY 374
            :||.||.||                                 ||........|.|||...|..  
  Fly   453 EDQRSCALD---------------------------------SCTDLENPQLNRTRCAHECQD-- 482

  Fly   375 IMQGSQFAVCGHTGLWSSPEAKCVESLALSCPVLTPPRNGRFYPASCNNEPSKSLAICELLCDRG 439
            :.:||...||......|..:..|   |....|..|.....:..|.:|......:...|  :|..|
  Fly   483 LPEGSYRCVCPKGYELSEDQHSC---LVQESPCSTEKGVEKCSPGTCLASEDNTSFSC--ICPTG 542

  Fly   440 Y 440
            |
  Fly   543 Y 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 20/41 (49%)
vWFA <158..199 CDD:294047 25/40 (63%)
FXa_inhibition 287..315 CDD:291342 17/27 (63%)
CCP 340..398 CDD:153056 12/57 (21%)
fracNP_001137905.1 FXa_inhibition 296..331 CDD:291342 21/35 (60%)
cEGF 396..415 CDD:289433 12/18 (67%)
FXa_inhibition 425..458 CDD:291342 18/38 (47%)
FXa_inhibition 476..505 CDD:291342 7/30 (23%)
vWFA <550..586 CDD:294047
FXa_inhibition 596..630 CDD:291342
FXa_inhibition 636..>664 CDD:291342
EGF_CA 676..715 CDD:284955
FXa_inhibition 745..780 CDD:291342
FXa_inhibition 786..821 CDD:291342
FXa_inhibition 827..862 CDD:291342
FXa_inhibition 874..904 CDD:291342
FXa_inhibition 945..980 CDD:291342
CCP 1110..1170 CDD:153056
CCP 1183..1235 CDD:153056
DUF5011 1468..1536 CDD:295940
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I12027
eggNOG 1 0.900 - - E33208_3BA2W
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002570
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24034
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.