DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and clec14a

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_956080.1 Gene:clec14a / 327325 ZFINID:ZDB-GENE-030131-5536 Length:368 Species:Danio rerio


Alignment Length:258 Identity:67/258 - (25%)
Similarity:93/258 - (36%) Gaps:52/258 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LKRAKDNALYCSNGIWLGLKPN---CIKIGKGNTHSMKQKKMRCRIDNGGCAHICNRSTHKCECY 145
            ||...|.....:...|:|||.:   |:|.|.      ..|.....:||         ||..    
Zfish    60 LKTIWDKTNRTAASFWVGLKKDKGVCVKQGS------PLKGFHWTVDN---------STQS---- 105

  Fly   146 EGYTLNSTDLRSCNDIDEC----------KESNGGCSQVCNNLPGEFICTCNSGFEIDESD-EKT 199
            ||....|....:|.|: .|          ..:|.|...........|||..|........: .||
Zfish   106 EGNMWKSEPSHTCTDV-RCGLLSVEYGNSGATNSGFMDATCKQQHAFICKRNMETMCQRPEIPKT 169

  Fly   200 CLDIDECADPELSWDCTAGCKN-LNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSE 263
            ...||...||   :.|...|.: .|.|..|....|..:...:........:.|.||:: .|....
Zfish   170 QYIIDYPEDP---YTCQVVCNSGANYTLTCSHDSVWTIVGKENIDVFQLCLECVSGYR-RDASGN 230

  Fly   264 CQDINECDLADIDSDSWRMTYRYCEHKCENTVGSYICHCPQ--GYHLLDDQNSCILDGSKLPP 324
            |:|||||:    :|:.       |.|.|:||.|||||..|:  ..||..|::|...:|..:.|
Zfish   231 CEDINECE----ESNP-------CNHGCKNTYGSYICDEPKLPTTHLKSDESSHNDEGKSVQP 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 7/33 (21%)
vWFA <158..199 CDD:294047 9/51 (18%)
FXa_inhibition 287..315 CDD:291342 14/29 (48%)
CCP 340..398 CDD:153056
clec14aNP_956080.1 CLECT 25..154 CDD:295302 25/113 (22%)
EGF_CA 233..>257 CDD:214542 15/34 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.