DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and yl

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_996433.1 Gene:yl / 32367 FlyBaseID:FBgn0004649 Length:1984 Species:Drosophila melanogaster


Alignment Length:235 Identity:59/235 - (25%)
Similarity:87/235 - (37%) Gaps:62/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 KPNCIKIGKGNTHSMKQKKMRCRIDNGGCAHICNRSTHKCECYEGYTLNSTDLRS----CNDIDE 163
            :|:|.. ........||.::.|    .|..|:|              .|...||.    |:.:|:
  Fly   207 RPDCTD-KSDEVAGCKQAEITC----PGEGHLC--------------ANGRCLRRKQWVCDGVDD 252

  Fly   164 CKESNG--GCSQVCNNLPGEFICTCNSGFEIDESDEKTCLDIDECADPELSWDCTAGCKNLN--- 223
            |.:.:.  ||..:|....|:|:|          .:.:|||.:.|..|...  ||:.|....:   
  Fly   253 CGDGSDERGCLNLCEPQKGKFLC----------RNRETCLTLSEVCDGHS--DCSDGSDETDLCH 305

  Fly   224 -----GTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDINECDLADIDSDSWRMT 283
                 ...||.......:.|..|     .|..|..||:|:....:|:|::||...|         
  Fly   306 SKPDCDAKKCALGAKCHMMPASG-----AECFCPKGFRLAKFEDKCEDVDECKEQD--------- 356

  Fly   284 YRYCEHKCENTVGSYICHCPQGYHLLDDQNSC--ILDGSK 321
             ..|...||||.|.|.|.|..||.|..|..:|  ::.|||
  Fly   357 -DLCSQGCENTSGGYRCVCDAGYLLDKDNRTCRAVVYGSK 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 7/37 (19%)
vWFA <158..199 CDD:294047 9/42 (21%)
FXa_inhibition 287..315 CDD:291342 13/27 (48%)
CCP 340..398 CDD:153056
ylNP_996433.1 LDLa 90..124 CDD:238060
LDLa 131..166 CDD:238060
LDLa 184..216 CDD:238060 2/9 (22%)
LDLa 227..262 CDD:238060 10/52 (19%)
LDLa 271..302 CDD:238060 11/42 (26%)
FXa_inhibition 352..387 CDD:291342 15/44 (34%)
Ldl_recept_b 442..482 CDD:278487
LY 466..508 CDD:214531
Ldl_recept_b 529..569 CDD:278487
LY 553..595 CDD:214531
LY 596..637 CDD:214531
FXa_inhibition 669..700 CDD:291342
LY 774..815 CDD:214531
LDLa 1032..1062 CDD:238060
LDLa 1074..1109 CDD:238060
LDLa 1118..1152 CDD:238060
LDLa 1157..1189 CDD:197566
LDLa 1198..1232 CDD:238060
LDLa 1243..1279 CDD:238060
LDLa 1283..1318 CDD:238060
LDLa 1340..1371 CDD:197566
FXa_inhibition 1388..1416 CDD:291342
EGF_CA 1418..1452 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24034
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.