DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and Matn3

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001382499.1 Gene:Matn3 / 313954 RGDID:1305085 Length:481 Species:Rattus norvegicus


Alignment Length:253 Identity:71/253 - (28%)
Similarity:105/253 - (41%) Gaps:67/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 EHVFLVTYYSCRVNYKLKRAKDNALYCSNGIWLGLKPNCIKIGKGNTHSMKQKKMRCRIDNGGCA 132
            :|||.|..|.  |..||. |:....:|:..                         :|.:....|.
  Rat   235 DHVFYVETYG--VIEKLS-ARFQETFCALD-------------------------QCMLGTHQCQ 271

  Fly   133 HIC---NRSTHKCECYEGYTLNSTDLRSCNDIDECKESNGGCSQVC-NNLPGEFICTCNSGFEID 193
            |:|   ....|.|||.:|||||: |.::|:.||:|..:..||.|:| |:..|.:.|.|..|:.::
  Rat   272 HVCVSDGDGRHHCECSQGYTLNA-DGKTCSAIDKCALNTHGCEQICVNDRNGSYHCECYEGYTLN 335

  Fly   194 ESDEKTCLDIDECADPELSWDCTAGCKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLS 258
             :|.|||...|:||   |.   |.||:::     |:           .||.......|..|:.|:
  Rat   336 -ADRKTCAAQDKCA---LG---THGCQHI-----CV-----------NDGAGSHHCECFEGYTLN 377

  Fly   259 DDGSECQDINECDLADIDSDSWRMTYRYCEHKC-ENTVGSYICHCPQGYHLLDDQNSC 315
            .|...|...::|.|..          ..|:|.| .:...||.|.|..||.|.||:.:|
  Rat   378 ADKKTCSVRDKCALGT----------HGCQHICVSDGAVSYHCDCFPGYTLNDDKKTC 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 14/36 (39%)
vWFA <158..199 CDD:294047 14/41 (34%)
FXa_inhibition 287..315 CDD:291342 12/28 (43%)
CCP 340..398 CDD:153056
Matn3NP_001382499.1 vWFA 75..298 CDD:412136 24/91 (26%)
FXa_inhibition 305..341 CDD:405372 12/36 (33%)
FXa_inhibition 347..383 CDD:405372 13/57 (23%)
FXa_inhibition 389..425 CDD:405372 14/45 (31%)
Matrilin_ccoil 438..478 CDD:402147
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.