DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and Fbln7

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_215832.6 Gene:Fbln7 / 296145 RGDID:1310131 Length:439 Species:Rattus norvegicus


Alignment Length:328 Identity:81/328 - (24%)
Similarity:117/328 - (35%) Gaps:119/328 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TASLNDIPEIT--------PAIDNNLSFQYDDTCWTPPRIKNAKASVKLRRNGEHV---FLV--- 73
            ||..|.:.::|        ||:|            .||             ||:..   :||   
  Rat    63 TALQNTVSKMTPDAPPVSCPALD------------APP-------------NGKKFGSKYLVDHE 102

  Fly    74 TYYSCRVNYKLKRAKDNALYC-SNGIWLGLKPNCIKIGK-------------------------G 112
            .:::|...::|  ....::.| :||.|.|.:|.|....:                         |
  Rat   103 VHFTCNPGFQL--VGPXSVVCLANGTWTGEQPRCRDTSECSSQPCHNGGTCVEGVHHYRCICPPG 165

  Fly   113 NTHSMKQKKMRCRIDNG-----------GCAHICNRSTHKCECYEGYTLNST--DLRSCNDIDEC 164
            .|.:..|.:.:.....|           .||.: .|..| |.|..|:.|:.|  ....|.|::||
  Rat   166 KTGNRCQHQTQAAAPGGVAGDSAYSRAPRCAQV-EREQH-CSCEAGFHLSGTAGGHSVCQDVNEC 228

  Fly   165 KESNGG------CSQVCNNLPGEFICTCNSGFEIDESDEKTCLDIDECADPELSWDCTAG--CKN 221
             |..|.      |...|.|.||.:.|||.||:.| .:|.|:|.|:||||.|:..  |..|  |.|
  Rat   229 -EIYGQEGRPRLCMHACVNTPGSYRCTCPSGYRI-LADGKSCEDVDECAGPQHM--CPRGTTCIN 289

  Fly   222 LNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDINECDLADIDSDSWRMTYRY 286
            ..|.::|       |.|...:|......|..|.|       :|:. |.|.:     ||     |.
  Rat   290 TGGGFQC-------VNPECPEGSGNISYVKTSPF-------QCER-NPCPM-----DS-----RP 329

  Fly   287 CEH 289
            |.|
  Rat   330 CRH 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 10/46 (22%)
vWFA <158..199 CDD:294047 18/46 (39%)
FXa_inhibition 287..315 CDD:291342 2/3 (67%)
CCP 340..398 CDD:153056
Fbln7XP_215832.6 CCP 81..135 CDD:153056 17/80 (21%)
EGF_CA 136..172 CDD:238011 2/35 (6%)
vWFA <220..267 CDD:412136 18/48 (38%)
cEGF 250..273 CDD:403760 10/23 (43%)
EGF_CA 270..307 CDD:311536 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002570
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.