DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and GAS6

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_000811.1 Gene:GAS6 / 2621 HGNCID:4168 Length:678 Species:Homo sapiens


Alignment Length:177 Identity:67/177 - (37%)
Similarity:86/177 - (48%) Gaps:44/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 CECYEGYTLNSTDLRSCN-DIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLDIDE 205
            |.|..|:     ..|.|: |::||.:.||||.|:|:|.||.|.|:|:||||: .||.:||.||||
Human   142 CLCKAGW-----GGRLCDKDVNECSQENGGCLQICHNKPGSFHCSCHSGFEL-SSDGRTCQDIDE 200

  Fly   206 CADPELSWDCTAGCKNLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDINEC 270
            |||.|...:  |.||||.|:|.||                     |..||..|.....|:|::||
Human   201 CADSEACGE--ARCKNLPGSYSCL---------------------CDEGFAYSSQEKACRDVDEC 242

  Fly   271 DLADIDSDSWRMTYRYCEHKCENTVGSYICHCP--QGYHLLDDQNSC 315
                        ....||..|.|:.|||.|||.  .|..|..|.::|
Human   243 ------------LQGRCEQVCVNSPGSYTCHCDGRGGLKLSQDMDTC 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 4/15 (27%)
vWFA <158..199 CDD:294047 22/41 (54%)
FXa_inhibition 287..315 CDD:291342 13/29 (45%)
CCP 340..398 CDD:153056
GAS6NP_000811.1 Gla 53..92 CDD:306960
EGF_CA 118..153 CDD:238011 4/15 (27%)
FXa_inhibition 160..195 CDD:317114 19/35 (54%)
EGF_CA 197..>227 CDD:214542 18/52 (35%)
vWFA <232..273 CDD:320736 16/52 (31%)
LamG 298..450 CDD:238058
Laminin_G_2 513..651 CDD:308045
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7421
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.