DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and FBN1

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_000129.3 Gene:FBN1 / 2200 HGNCID:3603 Length:2871 Species:Homo sapiens


Alignment Length:404 Identity:114/404 - (28%)
Similarity:151/404 - (37%) Gaps:148/404 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 LKPN---CIKIGKGNTHSMKQKKMRCRID-----NGGCAHICNRSTHKCECYEGYTLNST-DLRS 157
            |.||   ||.|.:            |.:.     ||.|.::..:  ::|.|..||  :|| |...
Human  1146 LSPNISACIDINE------------CELSAHLCPNGRCVNLIGK--YQCACNPGY--HSTPDRLF 1194

  Fly   158 CNDIDECKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLDIDECAD-PELSWDCTAG-CK 220
            |.|||||...||||...|.|..|.:.|:|..||.: ..|:::|.|||||.| |.:   |..| |.
Human  1195 CVDIDECSIMNGGCETFCTNSEGSYECSCQPGFAL-MPDQRSCTDIDECEDNPNI---CDGGQCT 1255

  Fly   221 NLNGTYKCLPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDINECDLADIDSDSWRMTYR 285
            |:.|.|:||                     |..||..|:|...|.|:|||||          ...
Human  1256 NIPGEYRCL---------------------CYDGFMASEDMKTCVDVNECDL----------NPN 1289

  Fly   286 YC-EHKCENTVGSYICHCPQGYHLLDDQNSCILDGSKLPPSKDAPVSQEAPRKDI--CPLFKGPA 347
            .| ...||||.||:||||..||.....:..|                     .||  |.:     
Human  1290 ICLSGTCENTKGSFICHCDMGYSGKKGKTGC---------------------TDINECEI----- 1328

  Fly   348 NGKASCDKY--LQNGFNYTRCNITCNAGYIMQG----------------SQFAVCGHT------- 387
             |..:|.|:  ..|.....:|  :|:.|:|..|                ||.|.|.:|       
Human  1329 -GAHNCGKHAVCTNTAGSFKC--SCSPGWIGDGIKCTDLDECSNGTHMCSQHADCKNTMGSYRCL 1390

  Fly   388 --------GLWSSPEAKCVESLALSCPVLTPPRNGRFYPASCNNEPSKSLAICELLCDRGYLPRM 444
                    |...:...:|.|:|.| |      .||:     |.|.|....  ||  ||.|::|..
Human  1391 CKEGYTGDGFTCTDLDECSENLNL-C------GNGQ-----CLNAPGGYR--CE--CDMGFVPSA 1439

  Fly   445 DTQLI-----CAAP 453
            |.:..     |:.|
Human  1440 DGKACEDIDECSLP 1453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 11/39 (28%)
vWFA <158..199 CDD:294047 18/40 (45%)
FXa_inhibition 287..315 CDD:291342 13/28 (46%)
CCP 340..398 CDD:153056 16/90 (18%)
FBN1NP_000129.3 TB 195..>228 CDD:334208
EGF_CA 246..>276 CDD:214542
EGF_CA 288..329 CDD:214542
TB 345..389 CDD:334208
EGF_CA 490..521 CDD:214542
EGF_CA 530..571 CDD:214542
EGF_CA 572..612 CDD:214542
EGF_CA 613..646 CDD:214542
TB 670..711 CDD:334208
EGF_CA 723..763 CDD:311536
EGF_CA 765..806 CDD:238011
TB 862..>894 CDD:334208
TB 967..1009 CDD:334208
EGF_CA 1070..1104 CDD:214542
EGF_CA 1113..1149 CDD:214542 1/2 (50%)
EGF_CA 1155..1188 CDD:214542 9/48 (19%)
vWFA <1194..1235 CDD:350880 18/41 (44%)
EGF_3 1326..1361 CDD:315598 10/42 (24%)
EGF_3 1367..1402 CDD:315598 6/34 (18%)
cEGF 1426..1449 CDD:338440 7/26 (27%)
EGF_CA 1446..1486 CDD:214542 2/8 (25%)
EGF_CA 1487..1518 CDD:214542
TB 1549..1590 CDD:334208
EGF_CA 1606..1638 CDD:214542
EGF_CA 1648..1687 CDD:214542
TB 1706..1749 CDD:334208
EGF_CA 1766..>1797 CDD:214542
EGF_CA 1808..1840 CDD:214542
vWFA <1847..1886 CDD:350880
EGF_CA 1930..1971 CDD:311536
EGF_CA 1973..2008 CDD:238011
EGF_CA 2013..2053 CDD:354843
TB 2070..2112 CDD:334208
EGF_CA 2127..2165 CDD:214542
EGF_CA 2166..2205 CDD:214542
vWFA <2289..2328 CDD:350880
TB 2356..2391 CDD:334208
vWFA <2442..2482 CDD:350880
cEGF 2465..2488 CDD:338440
EGF_CA 2485..>2516 CDD:354843
EGF_CA 2524..2566 CDD:214542
EGF_CA 2567..>2596 CDD:214542
EGF_CA 2607..2638 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.