DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and B0393.5

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_497982.2 Gene:B0393.5 / 175632 WormBaseID:WBGene00007170 Length:1183 Species:Caenorhabditis elegans


Alignment Length:275 Identity:74/275 - (26%)
Similarity:105/275 - (38%) Gaps:83/275 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 RCRIDNGGCAHICNRSTHKCECYEGYTLNSTDLRSCNDIDECKESNGGC--SQVCNNLPGEFICT 185
            ||. .|..|      |...|.|.||:|   .|...|.|:|||:.....|  ..:|:|..|.|.||
 Worm   452 RCD-QNAKC------SNGVCTCSEGFT---GDGFRCYDVDECEIPGAVCRDHSICSNTIGSFECT 506

  Fly   186 CNSGFEIDESDEKTCLDIDECAD-PELSWDCTAG--CKNLNGTYKCLPSLVGRVEPTDGDGFSPG 247
            |:.|:..::.   .|.|:|||.: |::..|...|  |.|.:||::||                  
 Worm   507 CHGGYRFEDG---KCEDVDECRELPKICGDPNKGTKCINKDGTFECL------------------ 550

  Fly   248 EIVCKSGFKLSDDGSECQDINECDLADIDSDSWRMTYRYC--EHKCENTVGSYICHCPQGYHLLD 310
               ||.|:: .|..|||:|:|||...|.           |  ..:|.||.|.|.|.|..|:..:.
 Worm   551 ---CKDGYE-GDPSSECRDVNECKNPDA-----------CGPNSQCTNTQGGYECECLAGFERIA 600

  Fly   311 DQNSCILDGSKLPPSKDAPVSQEAPRKDICPLFKGPANGKASCDKYLQNGFNYTRCNITCNAGYI 375
            :...|                   ..:|.|.:  .|.:..|.|    .|.....:|.  |..|::
 Worm   601 EGAHC-------------------TDRDECAV--EPCHPAAIC----SNTRGSYKCE--CRDGFV 638

  Fly   376 MQGSQFAVCGHTGLW 390
            ..|.   .|..|.|:
 Worm   639 GDGK---TCHETILY 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 10/33 (30%)
vWFA <158..199 CDD:294047 14/42 (33%)
FXa_inhibition 287..315 CDD:291342 9/29 (31%)
CCP 340..398 CDD:153056 12/51 (24%)
B0393.5NP_497982.2 NIDO 120..255 CDD:214712
EGF_3 453..477 CDD:289699 10/33 (30%)
EGF_CA 479..>512 CDD:284955 13/32 (41%)
EGF_CA 520..563 CDD:284955 18/64 (28%)
EGF_CA 565..606 CDD:214542 15/70 (21%)
EGF_3 611..644 CDD:289699 9/43 (21%)
NIDO 714..850 CDD:214712
EGF_CA 912..952 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.