DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32373 and Matn4

DIOPT Version :9

Sequence 1:NP_001261534.1 Gene:CG32373 / 318000 FlyBaseID:FBgn0052373 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001239492.1 Gene:Matn4 / 17183 MGIID:1328314 Length:624 Species:Mus musculus


Alignment Length:365 Identity:85/365 - (23%)
Similarity:136/365 - (37%) Gaps:120/365 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVQNRMSTSVIVLYALMCIAFSTA-----SLNDIPEITPAIDNNLSFQYDDTCWTPPRIKNAKAS 60
            :.|..| |.:.:.|| |.:|||.|     |...:|.:...:.:.           .|:.:.|:.:
Mouse   109 LAQGTM-TGLAIQYA-MNVAFSEAEGARPSEERVPRVLVIVTDG-----------RPQDRVAEVA 160

  Fly    61 VKLRRNG-------------------------EHVFLVTYYSCRVNYKLKRAKDNALYCSNGIWL 100
            .:.|..|                         :|||||..:.....:.|:         ..|...
Mouse   161 AQARARGIEIYAVGVQRADVGSLRTMASPPLDQHVFLVESFDLIQEFGLQ---------FQGRLC 216

  Fly   101 GLKPNCIKIGKGNTHSMKQKKMRCRIDNGGCAHICNRS--THKCECYEGYTLNSTDLRSCNDIDE 163
            | |..|.::    .|              ||.|:|..:  |..|.|..||.| :.|.::|..:|.
Mouse   217 G-KDLCAEL----VH--------------GCQHLCVNAPGTFYCACNSGYKL-APDNKNCLALDL 261

  Fly   164 CKESNGGCSQVCNNLPGEFICTCNSGFEIDESDEKTCLDIDECADPELSWDCTAGCKNLNGTYKC 228
            |.|...||..:|.|....:.|.|.:||.: :.|:::|..||.|:....|      |:     ::|
Mouse   262 CAEGTHGCEHLCVNSVDSYFCRCRAGFAL-QQDQRSCRAIDYCSFGNHS------CQ-----HEC 314

  Fly   229 LPSLVGRVEPTDGDGFSPGEIVCKSGFKLSDDGSECQDINECDLADIDSDSWRMTYRYCEHKCEN 293
            :.:|.|            .:..|:.|..|..||..|:..:.|:  |:|..        ||.:|.:
Mouse   315 VSTLEG------------PQCRCREGHDLLPDGRSCRVRDFCN--DVDHG--------CEFQCVS 357

  Fly   294 TVGSYICHCPQGYHLLDDQNSC------------ILDGSK 321
            ...|:.|.||:|..|..|..||            ::||||
Mouse   358 EGLSFHCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSK 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32373NP_001261534.1 FXa_inhibition 124..158 CDD:291342 11/35 (31%)
vWFA <158..199 CDD:294047 13/40 (33%)
FXa_inhibition 287..315 CDD:291342 10/27 (37%)
CCP 340..398 CDD:153056
Matn4NP_001239492.1 vWA_Matrilin 33..255 CDD:238752 38/187 (20%)
FXa_inhibition 262..297 CDD:291342 11/35 (31%)
FXa_inhibition 303..338 CDD:291342 11/57 (19%)
FXa_inhibition 344..379 CDD:291342 13/44 (30%)
vWA_Matrilin 385..621 CDD:238752 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BA2W
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.